(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE385

PENCW_13.PE385       Location/Qualifiers
FT   CDS             join(complement(877290..877643),complement(871894..877242))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178230" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947715"
FT                   /orf_name="Pc16g03850"
FT                   /product="Pc16g03850 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="CAP93055.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831324"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z4"
FT                   /transl_table=1
FT                   /translation="MGEYIEPSASPWVGEELTKPNDAGWSDCMTLPTLSDIKHEEIIAL
FT                   AWVLLLFRGTVQNEDGGFSWLKEGSLQGGSISDVIEGEGSSLRSALEAIRRRGQFDGEF
FT                   SDTLLFRNASLDNEWTFALEAKLASGVVYVRGTPQSRTATQPVESVLPHILADLILSIA
FT                   NNLDQSVAEAVRIGRQELSQLWKWNGTMPPTIDQCIQDIISEKAQSQLDRPAVVSWDGE
FT                   MTYRQLEERSTNLARHLVDLGLQTGKAVPLCFEKSMWTIVGVLAVMKAGGALVLMDPSQ
FT                   PEGRLSTIASEVEAGFILTSEAQATLGARIVPGGKQVIVGPQNDEAEFKSLSVDLPVVP
FT                   ASSTLYIQFTSGSTGKPKGVLISHSNYTSGALPRAEAVGYKEHSRVLDFPSYAFDVSVD
FT                   CMLCTLANGGCICVPSEDQRVNDLSGAIRKLNVNMAHMTPSVARVLAPDIMPSLEVIGL
FT                   GGEAISASDAAEWGQKTKIVIAYGPSECTVGCTINNDIPPGRSYTSIGQGVGGTTWVVD
FT                   PSNHDRLMPIGTVGELLIEGPVVGDGYLNNPEKTAEVFIEDPTWLVEGGGDVPGRKGRL
FT                   YKTGDLVRYDPDASGSVVFIGRADQQVKLRGQRVELGEIEHHVRNYFPAGASVAAEVIF
FT                   PGGKKADATLIVFVAEEKSETTGTTSEITSFSSSFQKLIAGIDDILATNLPRYMIPTAY
FT                   IPLNQMPLLVSLKTDRKQLRALGNDLTRRHIAEFRSSTVVKIAPRTEMERKLHGLWLKL
FT                   FGDETDIGVNDHFFSLGGDSLKAMRLVAAAREQSLAIQVTDIFQSPILESLALKVKEVE
FT                   NKGPLEVPPFSLLPAGWEADAARVEAASLCNLDPSEVEDVYPCTPLQEALMALSAKYTD
FT                   AYVAQRVIELQDIQTAKRLQSAFEQVSAECAILRTRIAQVPRRGLMQIVVHANTPWLNS
FT                   SNLAEYLSSDTLKGMSLGTELARFAIVNDETSGKTYIVLSIHHALYDGWSMPLVVDRVN
FT                   RAYRGESIGSPAPFKNFIKWLGETDRSFTEKFWETQLEGATSLQFPPIPYTGYQARADS
FT                   LLEHYVNLPRASSSSTTSIATAIRGAWGLLAAHYTSSDDIVFGETMTGRTAPVAAVEEI
FT                   EGPMITTVPVRVCIDRKARASSYLQQIHDQTVDRIPHEHMGLQHIRRLNADAREACELR
FT                   TGIVIHPTIGEVEPSSKEEPATAFVPTSEAEAAREALKFNSYALMLVFTVDTKGFLVMA
FT                   SFDSKTIDIPQMDQALKQFDRLVQQILEDPTQKIQHIFDSTIETDVAEQCRLAKIGPAS
FT                   LPTEEVYSAATSTWIVNPNDHECLVPPGGVGELLVEKEDEMTSGNPVANPTWCKQPTKL
FT                   YTTNQLAKYTNDGSVIILRAKDAQIGQLQPRNKNLNGGAAITTATQQKLQRVWSQVLDI
FT                   PCEDILLDDSFFDLGGDSIRAMKLVSEARMDGLQLTVTTIFDHRSLFDMADHAVEAQAA
FT                   VTTSQDYAPFSSLNVTDLDEFINKITPLLAQPEWKIVDVYPSRPLQEIAVQGTVQLPRY
FT                   SMRYELFYMDTKVDRAQLFQSCQELVSRNEILRTVFVDHEGVSLGVVVDDLPCQIVEYE
FT                   IESDVEEFSQKLCDVDVQSRIPLGSPFLKFLFVRHVDGPSSLIMRISHAQYDEICLPIL
FT                   LQQLSALYEGRRVPKSLPFSSYVGHVTRTNLPASIPYWRDLLQGSSMTRIQPDIPVVSA
FT                   AHFAISKDVNIAARPREITVATLPTAAWALCLARRLSLDDVTFGEVVSGRNIDLPNADS
FT                   IVGPSWQYVPVRVKFGKEWTVMDLLQLVQRQHLESAQYEGIGLKEIVKDCTDWPETVDW
FT                   FDSVVHQDVEHVEDLSFMAASSRMQTIYPHFEPLREIKVQAFPKGDTLCIEIVTVESWS
FT                   DFAVSLLDDMIDTVGQLVNQVDSKIL"
     MGEYIEPSAS PWVGEELTKP NDAGWSDCMT LPTLSDIKHE EIIALAWVLL LFRGTVQNED        60
     GGFSWLKEGS LQGGSISDVI EGEGSSLRSA LEAIRRRGQF DGEFSDTLLF RNASLDNEWT       120
     FALEAKLASG VVYVRGTPQS RTATQPVESV LPHILADLIL SIANNLDQSV AEAVRIGRQE       180
     LSQLWKWNGT MPPTIDQCIQ DIISEKAQSQ LDRPAVVSWD GEMTYRQLEE RSTNLARHLV       240
     DLGLQTGKAV PLCFEKSMWT IVGVLAVMKA GGALVLMDPS QPEGRLSTIA SEVEAGFILT       300
     SEAQATLGAR IVPGGKQVIV GPQNDEAEFK SLSVDLPVVP ASSTLYIQFT SGSTGKPKGV       360
     LISHSNYTSG ALPRAEAVGY KEHSRVLDFP SYAFDVSVDC MLCTLANGGC ICVPSEDQRV       420
     NDLSGAIRKL NVNMAHMTPS VARVLAPDIM PSLEVIGLGG EAISASDAAE WGQKTKIVIA       480
     YGPSECTVGC TINNDIPPGR SYTSIGQGVG GTTWVVDPSN HDRLMPIGTV GELLIEGPVV       540
     GDGYLNNPEK TAEVFIEDPT WLVEGGGDVP GRKGRLYKTG DLVRYDPDAS GSVVFIGRAD       600
     QQVKLRGQRV ELGEIEHHVR NYFPAGASVA AEVIFPGGKK ADATLIVFVA EEKSETTGTT       660
     SEITSFSSSF QKLIAGIDDI LATNLPRYMI PTAYIPLNQM PLLVSLKTDR KQLRALGNDL       720
     TRRHIAEFRS STVVKIAPRT EMERKLHGLW LKLFGDETDI GVNDHFFSLG GDSLKAMRLV       780
     AAAREQSLAI QVTDIFQSPI LESLALKVKE VENKGPLEVP PFSLLPAGWE ADAARVEAAS       840
     LCNLDPSEVE DVYPCTPLQE ALMALSAKYT DAYVAQRVIE LQDIQTAKRL QSAFEQVSAE       900
     CAILRTRIAQ VPRRGLMQIV VHANTPWLNS SNLAEYLSSD TLKGMSLGTE LARFAIVNDE       960
     TSGKTYIVLS IHHALYDGWS MPLVVDRVNR AYRGESIGSP APFKNFIKWL GETDRSFTEK      1020
     FWETQLEGAT SLQFPPIPYT GYQARADSLL EHYVNLPRAS SSSTTSIATA IRGAWGLLAA      1080
     HYTSSDDIVF GETMTGRTAP VAAVEEIEGP MITTVPVRVC IDRKARASSY LQQIHDQTVD      1140
     RIPHEHMGLQ HIRRLNADAR EACELRTGIV IHPTIGEVEP SSKEEPATAF VPTSEAEAAR      1200
     EALKFNSYAL MLVFTVDTKG FLVMASFDSK TIDIPQMDQA LKQFDRLVQQ ILEDPTQKIQ      1260
     HIFDSTIETD VAEQCRLAKI GPASLPTEEV YSAATSTWIV NPNDHECLVP PGGVGELLVE      1320
     KEDEMTSGNP VANPTWCKQP TKLYTTNQLA KYTNDGSVII LRAKDAQIGQ LQPRNKNLNG      1380
     GAAITTATQQ KLQRVWSQVL DIPCEDILLD DSFFDLGGDS IRAMKLVSEA RMDGLQLTVT      1440
     TIFDHRSLFD MADHAVEAQA AVTTSQDYAP FSSLNVTDLD EFINKITPLL AQPEWKIVDV      1500
     YPSRPLQEIA VQGTVQLPRY SMRYELFYMD TKVDRAQLFQ SCQELVSRNE ILRTVFVDHE      1560
     GVSLGVVVDD LPCQIVEYEI ESDVEEFSQK LCDVDVQSRI PLGSPFLKFL FVRHVDGPSS      1620
     LIMRISHAQY DEICLPILLQ QLSALYEGRR VPKSLPFSSY VGHVTRTNLP ASIPYWRDLL      1680
     QGSSMTRIQP DIPVVSAAHF AISKDVNIAA RPREITVATL PTAAWALCLA RRLSLDDVTF      1740
     GEVVSGRNID LPNADSIVGP SWQYVPVRVK FGKEWTVMDL LQLVQRQHLE SAQYEGIGLK      1800
     EIVKDCTDWP ETVDWFDSVV HQDVEHVEDL SFMAASSRMQ TIYPHFEPLR EIKVQAFPKG      1860
     DTLCIEIVTV ESWSDFAVSL LDDMIDTVGQ LVNQVDSKIL                            1900
//

If you have problems or comments...

PBIL Back to PBIL home page