(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE386

PENCW_13.PE386       Location/Qualifiers
FT   CDS             join(878527..879492,879546..879908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671666"
FT                   /orf_name="Pc16g03860"
FT                   /product="Pc16g03860 protein"
FT                   /protein_id="CAP93056.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI0001831325"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z5"
FT                   /transl_table=1
FT                   /translation="MSSSTLPLVRLPEPYKTTYELHVVSTDRNLRKFQLLRAPRGDEGI
FT                   PPPKPLDHASLKFTDLAQPDPSSTPDEGNNSPWARAQRSPVTYITWEGSDTPTVGQIWN
FT                   VVYAIETLRSEFEIFRGVLSGTGSEILARELEGVGLAIAHPEPSAAPGKPIPTTTNHLG
FT                   QLVFSRSSFWQGAGSPFGTRPAWVSDPGIYSYMRKPLSEYPCRPRQHTVTTGFPERRVH
FT                   ALHPVRPPKPSPGSCIYSRYIPHLDEFFSVYALDYTNEEHLGLFNKWQNDPRVAQGWNE
FT                   TGTLEQHREYLRKIQEDPHQIAVLAKFNDTFFSYHEIYWAKEDHLGAYYDAGDWDRGRH
FT                   SLVGDERFRGPHRTIAWWSGLMHYIFLDDPRTEYVTGEPKYSNLAPLTYDHATGMNLAK
FT                   LVDLPHKRSALILGSREKFFHVAPLRFDGSDTLDRNPFRSLKL"
     MSSSTLPLVR LPEPYKTTYE LHVVSTDRNL RKFQLLRAPR GDEGIPPPKP LDHASLKFTD        60
     LAQPDPSSTP DEGNNSPWAR AQRSPVTYIT WEGSDTPTVG QIWNVVYAIE TLRSEFEIFR       120
     GVLSGTGSEI LARELEGVGL AIAHPEPSAA PGKPIPTTTN HLGQLVFSRS SFWQGAGSPF       180
     GTRPAWVSDP GIYSYMRKPL SEYPCRPRQH TVTTGFPERR VHALHPVRPP KPSPGSCIYS       240
     RYIPHLDEFF SVYALDYTNE EHLGLFNKWQ NDPRVAQGWN ETGTLEQHRE YLRKIQEDPH       300
     QIAVLAKFND TFFSYHEIYW AKEDHLGAYY DAGDWDRGRH SLVGDERFRG PHRTIAWWSG       360
     LMHYIFLDDP RTEYVTGEPK YSNLAPLTYD HATGMNLAKL VDLPHKRSAL ILGSREKFFH       420
     VAPLRFDGSD TLDRNPFRSL KL                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page