(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE387

PENCW_13.PE387       Location/Qualifiers
FT   CDS             join(880563..880595,880644..881562,881621..884634)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19824347"
FT                   /orf_name="Pc16g03870"
FT                   /product="Pc16g03870 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93057.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831326"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z6"
FT                   /transl_table=1
FT                   /translation="MAEDAPAQKRSWRDRAVFFRLFVYGEPSRSDIALLVLGLVSAIAS
FT                   GIPFPIMSIVFGQLVDEMNSTTCNVNDTNGDAYQAGINDKVLMIVYIGIAYLVLIYIYV
FT                   FSWNLTGERLAQRLREKYFKALLRQDVAFFDNLPAGEASSRITGDITTVQQGTSEKVGI
FT                   VINSLAFFVTAYVVAFIKDPKLAGMLVSLTPAYLIMSLLGGYFVQKYFGRALESMTKAS
FT                   SVALEAFSNTMVVHAFSANARLEEKFIEFLNPGRIAGIRKSIATATQAGLLYFIAFSAN
FT                   ALAFWQGSTKIADSVESNDSSMTVGATYTVIFILVDASLILSTVAPFIQSFDAASVAFT
FT                   KLKADIDHSSAIDGTSKDIGEVLPEVKGHVELRDVSFCFPSRPDKPVLQNLSLSCPAGK
FT                   QTAIVGLSGSGKSTVAGLATRFYDATEGTVMLDGHDVKDLNVRALRSHISLVQQEPCLL
FT                   DRSIFENIAMGLINSPAHTHLQPILTGTALIEIAAAVREGQALSAAALEHGDQAREVVD
FT                   LVESATKLADANVFIEKLQEGYGTSVGSSGNLISGGQKQRISLARALVKDPRILILDEA
FT                   TASLDSATEMRIQRALESVAVGRTVITIAHRLSTIRNADNIIVMRQGKLVEQGTHTELL
FT                   AANGAYAELIRLQNLNVENSQEGTSTRSASPVTQITEKVEPNLSVTDDVPDKDETVDTP
FT                   AAQESKPKETGGVVDTNRSFASTVGSLGSMFRPYSFVLVLAVTGAVVIGGTYCASAVIF
FT                   GNVVGKLSGCEEPQNIRDAGEFYGLMFFVLAIIEFFANFFSWSLFGWMAENVIYKVRVL
FT                   SLRAILEQDLQWHESNDRNPSLLLSLITKDSNALAGLTGSVVCTILSILINLFAAIIMS
FT                   HIIAWRIAIVCLAVVPLLLAAGWMRVTSLAQFEERHLEAFARSVGITVEAVNSIKTVMS
FT                   LSVEDEIMGTYRRSLAAPMREITRQSAWANVWLAIGYGLSNFLYGLAYWWGAKNIIAGY
FT                   YSQTQFFIVQLALLVSSQLWGQMFALAPDVSRAFQATRRLLNLLDLGTTKKLSAPIELL
FT                   PSKLLQSTSDVESTANAREKVDDTRNGISVSLKQVHFAYPARPDTRVLHGLDIDVKPGQ
FT                   FAALVGPSGAGKSTIISLVERLYSPESGTIHVDGRDVAYGDISFRDNIAYVPQQSVMFE
FT                   GTIRFNLALGARPGHEVTQDELEEACKLANIHDVISQLPDGYDTHCGPNGDRLSGGQKQ
FT                   RLAIARALIRKPKLLLLDESTSALDAESERLLQDGLEKAAKNMTVIAIAHRLYTIRKAD
FT                   VIFLIEDGRCVEQGTHTQLIERSETYRVNALNQTVDG"
     MAEDAPAQKR SWRDRAVFFR LFVYGEPSRS DIALLVLGLV SAIASGIPFP IMSIVFGQLV        60
     DEMNSTTCNV NDTNGDAYQA GINDKVLMIV YIGIAYLVLI YIYVFSWNLT GERLAQRLRE       120
     KYFKALLRQD VAFFDNLPAG EASSRITGDI TTVQQGTSEK VGIVINSLAF FVTAYVVAFI       180
     KDPKLAGMLV SLTPAYLIMS LLGGYFVQKY FGRALESMTK ASSVALEAFS NTMVVHAFSA       240
     NARLEEKFIE FLNPGRIAGI RKSIATATQA GLLYFIAFSA NALAFWQGST KIADSVESND       300
     SSMTVGATYT VIFILVDASL ILSTVAPFIQ SFDAASVAFT KLKADIDHSS AIDGTSKDIG       360
     EVLPEVKGHV ELRDVSFCFP SRPDKPVLQN LSLSCPAGKQ TAIVGLSGSG KSTVAGLATR       420
     FYDATEGTVM LDGHDVKDLN VRALRSHISL VQQEPCLLDR SIFENIAMGL INSPAHTHLQ       480
     PILTGTALIE IAAAVREGQA LSAAALEHGD QAREVVDLVE SATKLADANV FIEKLQEGYG       540
     TSVGSSGNLI SGGQKQRISL ARALVKDPRI LILDEATASL DSATEMRIQR ALESVAVGRT       600
     VITIAHRLST IRNADNIIVM RQGKLVEQGT HTELLAANGA YAELIRLQNL NVENSQEGTS       660
     TRSASPVTQI TEKVEPNLSV TDDVPDKDET VDTPAAQESK PKETGGVVDT NRSFASTVGS       720
     LGSMFRPYSF VLVLAVTGAV VIGGTYCASA VIFGNVVGKL SGCEEPQNIR DAGEFYGLMF       780
     FVLAIIEFFA NFFSWSLFGW MAENVIYKVR VLSLRAILEQ DLQWHESNDR NPSLLLSLIT       840
     KDSNALAGLT GSVVCTILSI LINLFAAIIM SHIIAWRIAI VCLAVVPLLL AAGWMRVTSL       900
     AQFEERHLEA FARSVGITVE AVNSIKTVMS LSVEDEIMGT YRRSLAAPMR EITRQSAWAN       960
     VWLAIGYGLS NFLYGLAYWW GAKNIIAGYY SQTQFFIVQL ALLVSSQLWG QMFALAPDVS      1020
     RAFQATRRLL NLLDLGTTKK LSAPIELLPS KLLQSTSDVE STANAREKVD DTRNGISVSL      1080
     KQVHFAYPAR PDTRVLHGLD IDVKPGQFAA LVGPSGAGKS TIISLVERLY SPESGTIHVD      1140
     GRDVAYGDIS FRDNIAYVPQ QSVMFEGTIR FNLALGARPG HEVTQDELEE ACKLANIHDV      1200
     ISQLPDGYDT HCGPNGDRLS GGQKQRLAIA RALIRKPKLL LLDESTSALD AESERLLQDG      1260
     LEKAAKNMTV IAIAHRLYTI RKADVIFLIE DGRCVEQGTH TQLIERSETY RVNALNQTVD      1320
     G                                                                      1321
//

If you have problems or comments...

PBIL Back to PBIL home page