(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE388

PENCW_13.PE388       Location/Qualifiers
FT   CDS             join(complement(885998..886193),complement(885592..885942),
FT                   complement(884877..885539),complement(884789..884829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947716"
FT                   /orf_name="Pc16g03880"
FT                   /product="Pc16g03880 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93058.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831327"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z7"
FT                   /transl_table=1
FT                   /translation="MPGLEEQPPFKVLIVGGSYSGLAATLNLIDLCHGRKCRFNLDENE
FT                   KGPGHTIPVQVTIVDERDGYYHLIGLPLAMASNADASTFWKKFDDIPALQSPDINHIQG
FT                   RVDSIDCKSRIARIRQNTSNDGHKIIEEKYDFMVACSGLRREWPSAPKSLTREAYLAET
FT                   AESVQTIEEASAGVVVIGGGAVGIEIAAEIKMVQPEAKVTLIHSRQQLLSSEDLPDEFK
FT                   EKTLEMLKESGVEVVMGARVQDTVRGDESAPAKYTLKLSDGRELAADHVINAVSRFAPT
FT                   SSYLPKEACDAEGYVRITPGLQFSADVPNKKYHYAAGDIVAWSGIKRGGQAMHQAHFAV
FT                   FNIHQQMLAERYNTEPKFVELVDVAPMMALALGKTAVGYFPAMGLSSGDEIRNMFFNDD
FT                   LGYEICWKWMRLGEATE"
     MPGLEEQPPF KVLIVGGSYS GLAATLNLID LCHGRKCRFN LDENEKGPGH TIPVQVTIVD        60
     ERDGYYHLIG LPLAMASNAD ASTFWKKFDD IPALQSPDIN HIQGRVDSID CKSRIARIRQ       120
     NTSNDGHKII EEKYDFMVAC SGLRREWPSA PKSLTREAYL AETAESVQTI EEASAGVVVI       180
     GGGAVGIEIA AEIKMVQPEA KVTLIHSRQQ LLSSEDLPDE FKEKTLEMLK ESGVEVVMGA       240
     RVQDTVRGDE SAPAKYTLKL SDGRELAADH VINAVSRFAP TSSYLPKEAC DAEGYVRITP       300
     GLQFSADVPN KKYHYAAGDI VAWSGIKRGG QAMHQAHFAV FNIHQQMLAE RYNTEPKFVE       360
     LVDVAPMMAL ALGKTAVGYF PAMGLSSGDE IRNMFFNDDL GYEICWKWMR LGEATE           416
//

If you have problems or comments...

PBIL Back to PBIL home page