(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE389

PENCW_13.PE389       Location/Qualifiers
FT   CDS             join(886545..886935,886987..887288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947717"
FT                   /orf_name="Pc16g03890"
FT                   /product="Pc16g03890 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93059.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831328"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z8"
FT                   /transl_table=1
FT                   /translation="MGFVVVPATLPDIRAIYDVWFAAFKGQLILDLIYPGTDINDEAFR
FT                   KVHTEGALEYWKGLSTEHTFQCIDTDTGKIAGMATWQVYWRERTAEERQKPWIGWLEGD
FT                   QRSRAEGFLEQLWEKREKWIGPKKHVYCHTVAVHPDYQGKGVGAQLMQWGMNVAEQLDL
FT                   PVYLESTVEGVPLYKKLGFQTLSEGIVFKPEITRVDKEVRAPLMAKMPTSAGNMTFEEW
FT                   AEGKTSSV"
     MGFVVVPATL PDIRAIYDVW FAAFKGQLIL DLIYPGTDIN DEAFRKVHTE GALEYWKGLS        60
     TEHTFQCIDT DTGKIAGMAT WQVYWRERTA EERQKPWIGW LEGDQRSRAE GFLEQLWEKR       120
     EKWIGPKKHV YCHTVAVHPD YQGKGVGAQL MQWGMNVAEQ LDLPVYLEST VEGVPLYKKL       180
     GFQTLSEGIV FKPEITRVDK EVRAPLMAKM PTSAGNMTFE EWAEGKTSSV                  230
//

If you have problems or comments...

PBIL Back to PBIL home page