(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE39

PENCW_13.PE39        Location/Qualifiers
FT   CDS             join(86693..86744,86795..87762)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945518"
FT                   /orf_name="Pc16g00390"
FT                   /product="Pc16g00390 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0001831E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U2"
FT                   /transl_table=1
FT                   /translation="MNRIDVHHHFIPPAYVKAFNSTPGDPSGWHLPKWTPESTLSLMAS
FT                   HSTRTAILSLTAPGTSILCNFPVESANLARQINLYGSQLHQESPTRFGFFASLPHLTPE
FT                   TIPSAIEELAYALDTLQADGITLYTRYSGTGYLGHAAFAPLWEELNRRKAVVFIHPTNT
FT                   AADAQNKPEMVNPKLPQPIIDYPHETCRTAVDLITSGTISKNPDVKIILSHGGGTLPIL
FT                   ATRAANLLYDAGLTDITPEVFLEQARSFYLDLALSGNRGNLELLVGNNGFAKPGHVLYG
FT                   SDFPYAPVETINKYVGMMEEFFAQGGNKEEEVARAAAVELFPRFRIEDNKEMIPQNGL"
     MNRIDVHHHF IPPAYVKAFN STPGDPSGWH LPKWTPESTL SLMASHSTRT AILSLTAPGT        60
     SILCNFPVES ANLARQINLY GSQLHQESPT RFGFFASLPH LTPETIPSAI EELAYALDTL       120
     QADGITLYTR YSGTGYLGHA AFAPLWEELN RRKAVVFIHP TNTAADAQNK PEMVNPKLPQ       180
     PIIDYPHETC RTAVDLITSG TISKNPDVKI ILSHGGGTLP ILATRAANLL YDAGLTDITP       240
     EVFLEQARSF YLDLALSGNR GNLELLVGNN GFAKPGHVLY GSDFPYAPVE TINKYVGMME       300
     EFFAQGGNKE EEVARAAAVE LFPRFRIEDN KEMIPQNGL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page