(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE390

PENCW_13.PE390       Location/Qualifiers
FT   CDS             join(888312..889145,889206..889889)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824348"
FT                   /orf_name="Pc16g03900"
FT                   /product="Pc16g03900 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93060.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001831329"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z9"
FT                   /transl_table=1
FT                   /translation="MAMRKAAPPYPSFFKWVASVLKDEQGRPFIVVRDQGKKKRQHGTE
FT                   AVKSHIVAAKTVASIVKSSLGPRGLDKILISPDGDITVTNDGATILGQMEITNNVAKLL
FT                   VELSQSQDEEIGDGTTGVVVLAAAMLEQASDLIDKGIHPIRIADGYDQACEIAVAELDR
FT                   ISDEITFSKDDTTNLLKVAKTSLGSKIVSKSHDQFAKIAVDAVLSVADFERKDVDFELI
FT                   KVDGKVGGSLEDSLLVRGVIVDKDFSHPQMPDEVRDAKLAILTCPFEPPKPKTKHKLDI
FT                   TSVEEFKKLQDYEKEKFTEMIQQLKESGANLVICQWGFDDEANHLLLQNDLPAVRWVGG
FT                   PEIELIAIATNGRIVPRFEDLSSDKLGTAGVVREMSFGTTREKMLVIEECANTRAVTIF
FT                   VRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSIAVEDAAVKSPGIEQ
FT                   YAMRAFADALDAVPLALSENSGLSPIETLASIKSRQVKEKNTRLGVDCMMTGTNGIRRS
FT                   FHIQFRSWANLDSSDMREHFAIDPLIGKRQQLLLATQLCRMVLKINNVIISGDDQSEF"
     MRISSAFAAL CGLQAALAMA ENTTXPWQTF KSSPYEPPSL KISKSGPTSP GYLFFDQSWD        60
     AHQYSVFIMS DKNELVWQSP RGDLKGFRVQ KLDGKLVLTY FNGLGVPEPF GWGYGIIQVL       120
     DESYQSIYNV SVTNDNYKAL GSIDSSSFVS WIDMHENTMT PDGTMLVTGY NVTRADLSSV       180
     GGPKDGWIAD SLFYEIDVKT NEILFRWSAL DHIDQIPLEH VQPFYPIKDW GRNSSYPYGY       240
     FHINSVDKFQ DGTYIISSRY YCSLFKIAKD GSVDWTLQGQ TGGDFNLNGI KFSYQHDARI       300
     HNEAEDGFML SIFDNANSDV QNGTHHTEGI LMNVNLATRE VSLVQTLHDS RDEIFSTSQG       360
     NTQLLPGNHA IMGYGSNPKI KEYNSNGTCV MTAQFGLDAV VASYRAYRSP WVGVPKTLPD       420
     VFSCIEQGRN KTNVYMSWNG ATEHRMWKVF GGANASDLSP VAAVRKTGFE TVASIKGKLG       480
     YVQVEAHGLG IEKGVSKVVS VKGRC                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page