(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE391

PENCW_13.PE391       Location/Qualifiers
FT   CDS             join(complement(891934..892148),complement(891580..891867),
FT                   complement(890263..891514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947718"
FT                   /orf_name="Pc16g03910"
FT                   /product="Pc16g03910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93061.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018313F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H800"
FT                   /transl_table=1
FT                   /translation="MASKETQIAQVTAADVTYPTEKETETAQPPAYAADGNSDQESLDQ
FT                   EAQAGVKGVQAAAAVWTKSHLILAYVIIWFIYFVTSIQEVVIRSLNPYVTSAFELHSLT
FT                   AATNIMANIIGGLSKIPLAKILDSWGRPQGMSLMLLIWVVGFIMMAGCNNVQTYAAAQV
FT                   FSSVGSQGVSYCLTVFISDTSSLKNRALMLSYATSPYIITTWIGGPIAQSVLGGPGWRW
FT                   GFGIFTIVVPVVVAPLCLLFFWNQHKAKKMGLLAPSRGPLTLSTIKQYCIEVDLIGIIL
FT                   LAGGMALFLLPFSLWSYQKDQWRSAMIICMIIFGGLLLIAFALYERFWAPVTFIPFNLL
FT                   MDRTVFFGGLMFVFEFFNSMVWGSYFGSMLQVVWGLDVTEASYVQAIYRVGSCLFCLLV
FT                   GVLIRWTGRFKWLAVYFSFPLMILGVGLMIKFRQPDAGIGYICMTQIFVAFAGGTTVIC
FT                   GELAMMAPSNHQHIAVILAMLNLFGSIGSAIGSTVSAAIWTSEFPKALAKYVPAEVNVA
FT                   KVYSDITAQLSYEWGSPARNAIAHAYGDAQRYMLITSVCMLVVAWGCAGMWRDIKIKDV
FT                   KQVKGRVI"
     MASKETQIAQ VTAADVTYPT EKETETAQPP AYAADGNSDQ ESLDQEAQAG VKGVQAAAAV        60
     WTKSHLILAY VIIWFIYFVT SIQEVVIRSL NPYVTSAFEL HSLTAATNIM ANIIGGLSKI       120
     PLAKILDSWG RPQGMSLMLL IWVVGFIMMA GCNNVQTYAA AQVFSSVGSQ GVSYCLTVFI       180
     SDTSSLKNRA LMLSYATSPY IITTWIGGPI AQSVLGGPGW RWGFGIFTIV VPVVVAPLCL       240
     LFFWNQHKAK KMGLLAPSRG PLTLSTIKQY CIEVDLIGII LLAGGMALFL LPFSLWSYQK       300
     DQWRSAMIIC MIIFGGLLLI AFALYERFWA PVTFIPFNLL MDRTVFFGGL MFVFEFFNSM       360
     VWGSYFGSML QVVWGLDVTE ASYVQAIYRV GSCLFCLLVG VLIRWTGRFK WLAVYFSFPL       420
     MILGVGLMIK FRQPDAGIGY ICMTQIFVAF AGGTTVICGE LAMMAPSNHQ HIAVILAMLN       480
     LFGSIGSAIG STVSAAIWTS EFPKALAKYV PAEVNVAKVY SDITAQLSYE WGSPARNAIA       540
     HAYGDAQRYM LITSVCMLVV AWGCAGMWRD IKIKDVKQVK GRVI                        584
//

If you have problems or comments...

PBIL Back to PBIL home page