(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE392

PENCW_13.PE392       Location/Qualifiers
FT   CDS             join(complement(893573..893635),complement(893255..893524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824349"
FT                   /orf_name="Pc16g03920"
FT                   /product="Pc16g03920 protein"
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAP93062.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI00018313F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H801"
FT                   /transl_table=1
FT                   /translation="MVGLSPEVKAELPEIISMFFPLNDIISLYKEMDEMDKCNFVIKSA
FT                   RCKELTQVEVLRKLCGDTSDVIRTSRPPGKAHFGLSKVIEAFLPGYKTYHRHWFLTLEN
FT                   SSRLLL"
     MVGLSPEVKA ELPEIISMFF PLNDIISLYK EMDEMDKCNF VIKSARCKEL TQVEVLRKLC        60
     GDTSDVIRTS RPPGKAHFGL SKVIEAFLPG YKTYHRHWFL TLENSSRLLL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page