(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE393

PENCW_13.PE393       Location/Qualifiers
FT   CDS             join(complement(894677..894758),complement(894535..894610),
FT                   complement(894343..894479),complement(893980..894071))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128690"
FT                   /orf_name="Pc16g03930"
FT                   /product="Putative uncharacterized protein Pc16g03930 "
FT                   /protein_id="CAP93063.1"
FT                   /db_xref="UniParc:UPI00018313F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H802"
FT                   /transl_table=1
FT                   /translation="MPWCLGDPLAGVVRVYPRRSCEGSDTRCTKEGARLSSPLVKKGSW
FT                   ELAEPECRYIRWREWDKLWGLGSANLLLLKHMLTVYEDGAWIAVMPMSHGRKEGGSKGY
FT                   NAERLMETSRCTVECEMILNSCGS"
     MPWCLGDPLA GVVRVYPRRS CEGSDTRCTK EGARLSSPLV KKGSWELAEP ECRYIRWREW        60
     DKLWGLGSAN LLLLKHMLTV YEDGAWIAVM PMSHGRKEGG SKGYNAERLM ETSRCTVECE       120
     MILNSCGS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page