(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE394

PENCW_13.PE394       Location/Qualifiers
FT   CDS             join(894901..895012,895077..896497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824350"
FT                   /orf_name="Pc16g03940"
FT                   /product="Pc16g03940 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93064.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018313FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H803"
FT                   /transl_table=1
FT                   /translation="MAGDIEESPEKHSHGTSHKLPDLQRRLKSRHLQMIAMGGAIGTGL
FT                   FIGSGSAIATAGPVGALIAFTFIGSIVYSVMIALGEVATYLPIAGAFATYATRLVDPSL
FT                   GFAMGWIYWFSWASTFALELTATGLIIQYWDDAIPMAIFIAVFWVVIIILNMFPVSCYG
FT                   EVEFWLSSIKIITVVGFMIFAICINAGVGREGYLGFRYWVHPGPFRAYLIEDSGQDALA
FT                   KFVGFWAILIKAGFSYQGTELVGIAAGETENPRRNIPSAIRKTFFRIVFFFVFTIFFVG
FT                   IVVPSDDKRLTSDDSGTNADASPFVIAAKRAGVNVLPSIINAVLLTVVLSAANSNVYSG
FT                   SRILVGLAHEGFAPRFFLKTTKHGVPYASVGFTALFGLLGFLNVSNAGATVFNWLMQIA
FT                   GLAGFITWASLNICHLAFMKALAAQGIPRDTLPYKAPWQPFFSWYGLFFNILIIITQGF
FT                   TAFIPKFSVTDFFINYLSLMLFAVLYIGHKVVFRPGFVKPKQADIDTGRFEE"
     MAGDIEESPE KHSHGTSHKL PDLQRRLKSR HLQMIAMGGA IGTGLFIGSG SAIATAGPVG        60
     ALIAFTFIGS IVYSVMIALG EVATYLPIAG AFATYATRLV DPSLGFAMGW IYWFSWASTF       120
     ALELTATGLI IQYWDDAIPM AIFIAVFWVV IIILNMFPVS CYGEVEFWLS SIKIITVVGF       180
     MIFAICINAG VGREGYLGFR YWVHPGPFRA YLIEDSGQDA LAKFVGFWAI LIKAGFSYQG       240
     TELVGIAAGE TENPRRNIPS AIRKTFFRIV FFFVFTIFFV GIVVPSDDKR LTSDDSGTNA       300
     DASPFVIAAK RAGVNVLPSI INAVLLTVVL SAANSNVYSG SRILVGLAHE GFAPRFFLKT       360
     TKHGVPYASV GFTALFGLLG FLNVSNAGAT VFNWLMQIAG LAGFITWASL NICHLAFMKA       420
     LAAQGIPRDT LPYKAPWQPF FSWYGLFFNI LIIITQGFTA FIPKFSVTDF FINYLSLMLF       480
     AVLYIGHKVV FRPGFVKPKQ ADIDTGRFEE                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page