(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE397

PENCW_13.PE397       Location/Qualifiers
FT   CDS             join(complement(903499..903874),complement(901731..903439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947720"
FT                   /orf_name="Pc16g03970"
FT                   /product="Pc16g03970 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP93067.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012959"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018313FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H864"
FT                   /transl_table=1
FT                   /translation="MAGLKRAVDGSEERNGKRSKTKEASTSKSKSVKSSSSSKKDSKKD
FT                   FKSTKSDKKPSKKVQKEESEDDDDFDIDDVSDEDIDALDALSDDEEMPDVSDEEEKQVS
FT                   DKKSDADDEDQQEAPKKANPNNNNSRESHIKQKALQQERKAAKPNADTVARSKKLWEQL
FT                   RRKSHVPLEQRKKLVKELFEIITNRVRDFVFKHDSVRVIQTALKYGNLEQRKLIAHELK
FT                   GTYKELAQSRYAKFLVGKLIVHGDDETRDLIIPEFYGHVKRLIRHPEGSWILDDIYRTV
FT                   ATKAQKDRLLREWYGPEFVIFQDENDTTSDLRKIIEAHPEKRGPIMNYLRELINLLVQK
FT                   KSTGFTMLHDAMLQYFLCTKPGSNEASEFIELLKGDEEGDLVKNLAFTKSGSRLMCLSL
FT                   AYSNAKDRKLLLRFFRDTVKVMAGDIYGHQVILAAYEVIDDTKLCAKSFFPELLNQNDG
FT                   EEARNEELCYQVNDLTARIAVLYPFVGERVKWLLPEVDNPVLEEVRDVRKETSKKDPAI
FT                   RRQELVKAASPTLLEFIAARASTLLETTFGCQFLAEVLFAADGDKTAALAAVAEAAKSH
FT                   TEARDTAHVGRLLKSLVQGGRFNPATKSIEKVEPALNFHAALYEQIKDEVMDWATGANP
FT                   FVIVALAESEDFEKKSELLKTLKKNKKALEQASASVVEKDGQKKPTPTSSGAKLLLSKI
FT                   "
     MAGLKRAVDG SEERNGKRSK TKEASTSKSK SVKSSSSSKK DSKKDFKSTK SDKKPSKKVQ        60
     KEESEDDDDF DIDDVSDEDI DALDALSDDE EMPDVSDEEE KQVSDKKSDA DDEDQQEAPK       120
     KANPNNNNSR ESHIKQKALQ QERKAAKPNA DTVARSKKLW EQLRRKSHVP LEQRKKLVKE       180
     LFEIITNRVR DFVFKHDSVR VIQTALKYGN LEQRKLIAHE LKGTYKELAQ SRYAKFLVGK       240
     LIVHGDDETR DLIIPEFYGH VKRLIRHPEG SWILDDIYRT VATKAQKDRL LREWYGPEFV       300
     IFQDENDTTS DLRKIIEAHP EKRGPIMNYL RELINLLVQK KSTGFTMLHD AMLQYFLCTK       360
     PGSNEASEFI ELLKGDEEGD LVKNLAFTKS GSRLMCLSLA YSNAKDRKLL LRFFRDTVKV       420
     MAGDIYGHQV ILAAYEVIDD TKLCAKSFFP ELLNQNDGEE ARNEELCYQV NDLTARIAVL       480
     YPFVGERVKW LLPEVDNPVL EEVRDVRKET SKKDPAIRRQ ELVKAASPTL LEFIAARAST       540
     LLETTFGCQF LAEVLFAADG DKTAALAAVA EAAKSHTEAR DTAHVGRLLK SLVQGGRFNP       600
     ATKSIEKVEP ALNFHAALYE QIKDEVMDWA TGANPFVIVA LAESEDFEKK SELLKTLKKN       660
     KKALEQASAS VVEKDGQKKP TPTSSGAKLL LSKI                                   694
//

If you have problems or comments...

PBIL Back to PBIL home page