(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE398

PENCW_13.PE398       Location/Qualifiers
FT   CDS             join(complement(905175..905325),complement(905063..905091),
FT                   complement(904870..905007),complement(904441..904806))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947721"
FT                   /orf_name="Pc16g03980"
FT                   /product="Pc16g03980 protein"
FT                   /protein_id="CAP93068.1"
FT                   /db_xref="UniParc:UPI00018313FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H865"
FT                   /transl_table=1
FT                   /translation="MPPFRNFLGRKSQPNGDTTALDDNHLSPNQRPAPIPIRNSHDEPT
FT                   EYKLSVVNDSGVYLPPSPPERPSFWRRYPGSSKSVNHRDLVDDNEPFSISRESFDSYRR
FT                   SFDISARSPIIHPDAAPSRTSLDSRFSRLTPSVTQCNSLSKSEIMEEETFEEVGLNDEA
FT                   KPKKKGFLSRFGDSGNDAQTSGPKSSTSSFGFHIPGRKRGQSGGGSELASVKVAPSAPA
FT                   PTDET"
     MPPFRNFLGR KSQPNGDTTA LDDNHLSPNQ RPAPIPIRNS HDEPTEYKLS VVNDSGVYLP        60
     PSPPERPSFW RRYPGSSKSV NHRDLVDDNE PFSISRESFD SYRRSFDISA RSPIIHPDAA       120
     PSRTSLDSRF SRLTPSVTQC NSLSKSEIME EETFEEVGLN DEAKPKKKGF LSRFGDSGND       180
     AQTSGPKSST SSFGFHIPGR KRGQSGGGSE LASVKVAPSA PAPTDET                     227
//

If you have problems or comments...

PBIL Back to PBIL home page