(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE399

PENCW_13.PE399       Location/Qualifiers
FT   CDS             join(complement(908115..908616),complement(907560..908062),
FT                   complement(907379..907490),complement(906962..907326),
FT                   complement(906523..906912),complement(906281..906470),
FT                   complement(906101..906207))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671667"
FT                   /orf_name="Pc16g03990"
FT                   /product="Pc16g03990 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93069.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018313FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H866"
FT                   /transl_table=1
FT                   /translation="MGRKPNQLILEFFHRGPKLEDASNRYQHTCKACGEVFPKGRIDSL
FT                   TNHLVKKCQAIPLRDRQRVLLRLHELPDLTDGDSNKDSPSGSKGKSADGGFPNRQNFDG
FT                   LNVLAEASRQVGASDVTKRGPGYTQSVTAGGKTVIVDPALEAEGFQGHSQGPDSKAEGT
FT                   ANAEGTPQSSNAPSIPALPSHTPGEHPASMSPPLGDASMSPESTSNARQSQLSMIAASA
FT                   NEMVPQGMSIDSDSDMKMNQWNQQLSTHEQLLFDSLQEHDPSLTAATQRAASYPRPIAM
FT                   NPNTQAKGFVNEFGNSTKPMKPKVRGRFTAERRREVQDVRKKGACLRCRMLKKPCSGDT
FT                   PCTTCASVESARLWKHPCLRTRLSDEFELYNANLNSTLAYHDTNSIKNQIKFEHYSGRI
FT                   EVTHFEESNSFMTFSGLQGHRTSVSALDPQLQALGDDQFAGPSQEVYLLDADSDDIPSK
FT                   LEMYIKKNASYFYERETSPFMKPTLLLAAELNQGKKDILLERVLELWVATHILVDTELT
FT                   WKTYYNPTLPPNSLHSLSQPSDEGRLPIEEVSDPESYGLLCSQLRAAMEKRASQLSKFV
FT                   INDLERRLLQRQKCGWFDTFIVAIILLNCVDRTCWLFRSWDNENFSQRWPLDKRPPYYF
FT                   NQSDRFADILEMLLRMRHIPPKATFRPDNGILKAVDGSDEHAIRWFDMIQITPYFIEER
FT                   KNAVFDPSDSRSLDCHHSASLLEPNNAT"
     MGRKPNQLIL EFFHRGPKLE DASNRYQHTC KACGEVFPKG RIDSLTNHLV KKCQAIPLRD        60
     RQRVLLRLHE LPDLTDGDSN KDSPSGSKGK SADGGFPNRQ NFDGLNVLAE ASRQVGASDV       120
     TKRGPGYTQS VTAGGKTVIV DPALEAEGFQ GHSQGPDSKA EGTANAEGTP QSSNAPSIPA       180
     LPSHTPGEHP ASMSPPLGDA SMSPESTSNA RQSQLSMIAA SANEMVPQGM SIDSDSDMKM       240
     NQWNQQLSTH EQLLFDSLQE HDPSLTAATQ RAASYPRPIA MNPNTQAKGF VNEFGNSTKP       300
     MKPKVRGRFT AERRREVQDV RKKGACLRCR MLKKPCSGDT PCTTCASVES ARLWKHPCLR       360
     TRLSDEFELY NANLNSTLAY HDTNSIKNQI KFEHYSGRIE VTHFEESNSF MTFSGLQGHR       420
     TSVSALDPQL QALGDDQFAG PSQEVYLLDA DSDDIPSKLE MYIKKNASYF YERETSPFMK       480
     PTLLLAAELN QGKKDILLER VLELWVATHI LVDTELTWKT YYNPTLPPNS LHSLSQPSDE       540
     GRLPIEEVSD PESYGLLCSQ LRAAMEKRAS QLSKFVINDL ERRLLQRQKC GWFDTFIVAI       600
     ILLNCVDRTC WLFRSWDNEN FSQRWPLDKR PPYYFNQSDR FADILEMLLR MRHIPPKATF       660
     RPDNGILKAV DGSDEHAIRW FDMIQITPYF IEERKNAVFD PSDSRSLDCH HSASLLEPNN       720
     AT                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page