(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE4

PENCW_13.PE4         Location/Qualifiers
FT   CDS             join(complement(10378..10406),complement(9798..10266),
FT                   complement(9015..9624),complement(8497..8963))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128152"
FT                   /orf_name="Pc16g00040"
FT                   /product="Pc16g00040 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92674.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831CCD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R4"
FT                   /transl_table=1
FT                   /translation="MRKSWRAGVTAQIETVYHLLRPDAIEGRLPGRRRERVNYISPGPN
FT                   DVWHVDGHMKLEPFGIEIYAAIDGYSRYIVWPYVGVSARTAVSVQRQCLDVFAEYGFQP
FT                   RKIRSDRGTETVLLADTQYELRKLGDPSVQIRDCYLYGRSVDNQRIEGWWGLLSRATTG
FT                   LFHEYFKCLQRENLFVKDCIPEQVSLLAIYMPLIRCRVEAYTNQWNYHHIQSQPHRPHV
FT                   VKGKPIMNWKHADVPDLHCPINLDPTSEQGQLLQSLREDVQDWDPDEYLPPSTLTWCHQ
FT                   QLTEIGQQLVGIPFNPNDPNPALCGEPRAPYRAVYEALRERAFTHWNTGYNPILDVCIK
FT                   PHGAADWQGIGAAPANWQVADWQVTADWEVSRDFLSLINFSSSIDFSSSINFSSISSMA
FT                   APNSVLANAFVTALQQAGYTISAPATAPATAPATAPPPPYTATPYTAPPYTAPLYTAPP
FT                   YTAPPSTAPPSTPFSGLRGTVSSTRLAYQRQRGNQVAERDIPLTVTFYLQERPGETNCW
FT                   GGHVLIT"
     MRKSWRAGVT AQIETVYHLL RPDAIEGRLP GRRRERVNYI SPGPNDVWHV DGHMKLEPFG        60
     IEIYAAIDGY SRYIVWPYVG VSARTAVSVQ RQCLDVFAEY GFQPRKIRSD RGTETVLLAD       120
     TQYELRKLGD PSVQIRDCYL YGRSVDNQRI EGWWGLLSRA TTGLFHEYFK CLQRENLFVK       180
     DCIPEQVSLL AIYMPLIRCR VEAYTNQWNY HHIQSQPHRP HVVKGKPIMN WKHADVPDLH       240
     CPINLDPTSE QGQLLQSLRE DVQDWDPDEY LPPSTLTWCH QQLTEIGQQL VGIPFNPNDP       300
     NPALCGEPRA PYRAVYEALR ERAFTHWNTG YNPILDVCIK PHGAADWQGI GAAPANWQVA       360
     DWQVTADWEV SRDFLSLINF SSSIDFSSSI NFSSISSMAA PNSVLANAFV TALQQAGYTI       420
     SAPATAPATA PATAPPPPYT ATPYTAPPYT APLYTAPPYT APPSTAPPST PFSGLRGTVS       480
     STRLAYQRQR GNQVAERDIP LTVTFYLQER PGETNCWGGH VLIT                        524
//

If you have problems or comments...

PBIL Back to PBIL home page