(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE40

PENCW_13.PE40        Location/Qualifiers
FT   CDS             join(88167..88269,88331..88394,88448..89894)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977036"
FT                   /orf_name="Pc16g00400"
FT                   /product="Pc16g00400 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92710.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V2"
FT                   /transl_table=1
FT                   /translation="MALLYISTVAALALVLLFLRAVLNSWRIQRKLPPGPPGLPLIGNI
FT                   HQIPAVRAHQKFTEWAKVYGGLYSFRIGPATAAVITDRGLVKELLDKRSALYSSRPVSY
FT                   VGQNLITGGDHLLVMDNNEMWRLFRKTVHQHFKASMCEKEHVKLLEAEHTQMMRDFLLY
FT                   PEKHMLHTKRTTNSIIMSLLYGIRTPSWDTPHMQELYEIMEQWSKVMETGATPPVDIFP
FT                   WLKWIPQRWLGNWVDRSVEVGSGMKALYGSFRRRAIEARRQAEQSSQSRARTFIDHVLD
FT                   LQEKASLTDNQVDFLGGVMMEGGSDTGSTMLLVMIQALVQHPEVQERARAELDAVCGED
FT                   RSPTWADFSRLPYINMVVKETMRWRPVTPLSFPHALNQDDWVNGYLLPKGTTVFLNVWG
FT                   LHHDESVFPNPERFDPSHYEGRHNLASDYAASPDYMQRDHFIYGAGRRLCPGIHLSERS
FT                   MFIGAAKLLWGFQFESEMDESGRPVAIDTDPITGYTEGFLVCPRAYKCKVSPRSAARAE
FT                   TIMREFAQAEFEVLCQYATP"
     MALLYISTVA ALALVLLFLR AVLNSWRIQR KLPPGPPGLP LIGNIHQIPA VRAHQKFTEW        60
     AKVYGGLYSF RIGPATAAVI TDRGLVKELL DKRSALYSSR PVSYVGQNLI TGGDHLLVMD       120
     NNEMWRLFRK TVHQHFKASM CEKEHVKLLE AEHTQMMRDF LLYPEKHMLH TKRTTNSIIM       180
     SLLYGIRTPS WDTPHMQELY EIMEQWSKVM ETGATPPVDI FPWLKWIPQR WLGNWVDRSV       240
     EVGSGMKALY GSFRRRAIEA RRQAEQSSQS RARTFIDHVL DLQEKASLTD NQVDFLGGVM       300
     MEGGSDTGST MLLVMIQALV QHPEVQERAR AELDAVCGED RSPTWADFSR LPYINMVVKE       360
     TMRWRPVTPL SFPHALNQDD WVNGYLLPKG TTVFLNVWGL HHDESVFPNP ERFDPSHYEG       420
     RHNLASDYAA SPDYMQRDHF IYGAGRRLCP GIHLSERSMF IGAAKLLWGF QFESEMDESG       480
     RPVAIDTDPI TGYTEGFLVC PRAYKCKVSP RSAARAETIM REFAQAEFEV LCQYATP          537
//

If you have problems or comments...

PBIL Back to PBIL home page