(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE402

PENCW_13.PE402       Location/Qualifiers
FT   CDS             join(complement(914704..915398),complement(914576..914650),
FT                   complement(914439..914526))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671668"
FT                   /orf_name="Pc16g04020"
FT                   /product="Pc16g04020 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93072.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0001831400"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G8"
FT                   /transl_table=1
FT                   /translation="MSTICTEITSQCPVEATTYGYYPNLGGNIFFTIYFGLLGVCQLGL
FT                   GIYTRTWTFLAALGIGTLMEAAGYVGRILMHDNPWSTSGFRLQIFCLILAPTFIAAGIY
FT                   LTLKHIIIYIGPQYSRMNPKLFTWVFIGSDVGSIVLQAAGGGVANAAGTDQAMINTGNN
FT                   IIIAGIAFQVATMSVCGLLASDFFIASRKHLREGFQGEAATEKPQQRMWLVLVAEIGAY
FT                   TTVLIRCIYRLPEMAGGWGNKLMRNEMEFLVLDGMMIALACLVFTVVHPGLYLHTMRTG
FT                   RSRP"
     MSTICTEITS QCPVEATTYG YYPNLGGNIF FTIYFGLLGV CQLGLGIYTR TWTFLAALGI        60
     GTLMEAAGYV GRILMHDNPW STSGFRLQIF CLILAPTFIA AGIYLTLKHI IIYIGPQYSR       120
     MNPKLFTWVF IGSDVGSIVL QAAGGGVANA AGTDQAMINT GNNIIIAGIA FQVATMSVCG       180
     LLASDFFIAS RKHLREGFQG EAATEKPQQR MWLVLVAEIG AYTTVLIRCI YRLPEMAGGW       240
     GNKLMRNEME FLVLDGMMIA LACLVFTVVH PGLYLHTMRT GRSRP                       285
//

If you have problems or comments...

PBIL Back to PBIL home page