(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE403

PENCW_13.PE403       Location/Qualifiers
FT   CDS             join(915645..915679,915780..916803)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977576"
FT                   /orf_name="Pc16g04030"
FT                   /product="Pc16g04030 protein"
FT                   /protein_id="CAP93073.1"
FT                   /db_xref="UniParc:UPI0001831401"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G9"
FT                   /transl_table=1
FT                   /translation="MDAINARSGVSSACTARELPCVYSTPCPRRYSPTETSLKPEPKPP
FT                   AKPAFISPKYHAQHLLLMHKFSTETYKSICGDHSDIEGWQVLIPKLAFEHEFLLHGIFS
FT                   IAALHMAATNADPEQVLSYLDTALQCNELAFAPFREALAHLTPLNCDAVFAQSAIVTII
FT                   GIALPRLNAQHRGESFSMIETMMTVFELLQGASKISQISKPWRQASIFFKYDWRENTTL
FT                   DPDVANAIAQLRMLNGPIESTDSAQNSINQEAIDSLEDSFAKFTNAPHPAPILAWLTYV
FT                   KREFVHGLRERQPFQLLILMNWAVLLNELEASFWWAKGCGKALVAELLTELKDHNEKWK
FT                   SALQWPQQMVGI"
     MDAINARSGV SSACTARELP CVYSTPCPRR YSPTETSLKP EPKPPAKPAF ISPKYHAQHL        60
     LLMHKFSTET YKSICGDHSD IEGWQVLIPK LAFEHEFLLH GIFSIAALHM AATNADPEQV       120
     LSYLDTALQC NELAFAPFRE ALAHLTPLNC DAVFAQSAIV TIIGIALPRL NAQHRGESFS       180
     MIETMMTVFE LLQGASKISQ ISKPWRQASI FFKYDWRENT TLDPDVANAI AQLRMLNGPI       240
     ESTDSAQNSI NQEAIDSLED SFAKFTNAPH PAPILAWLTY VKREFVHGLR ERQPFQLLIL       300
     MNWAVLLNEL EASFWWAKGC GKALVAELLT ELKDHNEKWK SALQWPQQMV GI               352
//

If you have problems or comments...

PBIL Back to PBIL home page