(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE404

PENCW_13.PE404       Location/Qualifiers
FT   CDS             join(complement(921026..922497),complement(920829..920978),
FT                   complement(920071..920757),complement(918775..920032),
FT                   complement(918144..918728),complement(917785..918093),
FT                   complement(917317..917736),complement(916908..917159))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671669"
FT                   /orf_name="Pc16g04040"
FT                   /product="Pc16g04040 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93074.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831402"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H0"
FT                   /transl_table=1
FT                   /translation="MSSGPEKPKKVPRKHVTTACVPCRESKIRCDGATPHCQNCQRKGK
FT                   ECKYQHGDDKRNPHRQSHYLIFPRLKANVTRVSLRASTELFSARIDQLCHFIKEQGLEP
FT                   PPMNPEDEAGMNRVLDTLQIPRGFPQVSAVADEKRPPVEATASGVSSKSPSQDPPTVNP
FT                   KGQSPSTNPVACGASPAQDTASSGKVPSPEGWNPFGMVPGASDNQNFVHWGFTLPTAES
FT                   LDTIYANLNGGPRAPTMPRIPVNTEMNPDSYQLGMDMAQQPGSLLGQLPHEGDNDSDSG
FT                   EEDEAENDVIEQLSHRIGTLKIAGDGHLRFYGATSNLNLVDVSATQQRQRPDARTVRHD
FT                   GQDILNHLRVGQPVDQALEDHLVELYFTWQNPSTYIVDKEMYMTARTKWRNELDDTPFY
FT                   SEVLTNAMCAIGSAFEARYHPTFITFPKSLAEFFADRAKALLEIELDSPCVATVQALVI
FT                   MSCHEGASNRDARGWLYSGMSMRLAFDLGLHLDMTAYVNKGEITQLEADVRRATFWGSY
FT                   VADHFWGFYLGRPFRMNAGDIGVPKPGSALSPEKEENWHPYGHQAAHALSQNGLRNPME
FT                   LICRQFVVLWEMITPVGHILYGCSDISRHDLQRICYQVTEDLFAWKANLPSILQIDLND
FT                   DTSPILPHLMMLHMQYHQIIIFFHRPWLSKSYIQPRSPRQGPGYHHARRMCVESATAIA
FT                   RLLQLFEKHYTFRRMNNQVVAIIFSAALMLLFVTVSSSPMSPGKQGDSPTYPRSTEMVA
FT                   YLNLCFRALDELGQSFDNAKRTRDYLVTLQRRWQANMRRSGSATKRQNSSANLAALGSQ
FT                   KPSTQNTHASNAHGIDGWRKKSRLSVSGAPPNMQSTAPATTNHYSRLSQHTMPPQHQYH
FT                   QQSSYQQQAPFPVPRPDSQLGDLDWIPNSDMRLMSETQNGNALNDMGQIPSPPFPEDPS
FT                   MLSDIADIDAWWAPDNYTRTSMPP"
     MSTRVLSTDD RTVRGNQFAA YCADHPNFRI SPEIASFLSQ FEVRRPEATT QRRTRSTGST        60
     QQLYPPEWVV DVSLVRKELK QFYDTYKSSE LKAKKGSDAA IDESLPWSFD EDNNVYDRSV       120
     KVINLNAATD ESAQPEKMTP GNNCDTDTED EVDPDDQMIA EGRVKDEALL TQNGFDPIFI       180
     EGKYPGEIPA AIAEYLPEDQ SKPSWQMVGS NRSIFWIFGY NDVVDVIDDP ACLLDDEIVG       240
     VPNGVHPVSF LFARYASEDK VPRPLLQKYF DSWAPAPTTA FVMPVFDIPP LASDEPTNHQ       300
     IRDLYPLGRT RHFPSHLLCL RVKSNKRPEK TRDMVQEKLR DVFDFENDDL WFRGVNLKSL       360
     MLSMSFFVPV ISTSHSDNEF GPGIYATNDF GEGSKYAQPQ GAVMVFKNPD FRDLFVWEPA       420
     KDEWNRLTAT WLDIQKGNLK VSDSHNDADV IKGPMSSDQH EARKHGRYPS QGEITQITCV       480
     NYDSCRALAK SQSRQCEMWD TVLVPVSNNN CKSSLLLVGG RTEPLFVATT IQNTAVCVSN       540
     VYYRAIRSSL PPPALFRNTM YPVSIDSCFQ AGASSLWSGH RSSVDSLMLP AMIDGLTVMA       600
     QTSSPETGLA VADAEFTGIG RDDDPRRSKT NVKVYDPVNR NLLFRLSGLH YHSLDATVES       660
     HAAHTYTCLK WQPDVSFLSN NQLSTLLEAS EPGSSTAQAV AKIGQVINLV AHKNPRLRVL       720
     ELDLIDKAES VWVDRVKPIA SDIATELEYH LSVPSQTPLS PHGRNMEARI GMEDKDTYEI       780
     IILKASLYHP PSAPDIEKAR DHLSDRGFLC VLYDTSAFAG NLFTLGGLES ISTTESPKYA       840
     GELQLAYFGS AVAKETPASR APLHVTHFKS LNELKSKALT YLMENGWEVI EHSLPFNDVP       900
     ENGTVVVLGE MHSPVMSHLS DEQFESFRKL IELECRILWV TRGAQMQVTH PEHALFLAPR       960
     GRYMERTRPL LIMVLDVENA DGTASLGALH SVLKRLVSAE TLEDEDHEFT ERGGMVYISR      1020
     IVPDKAVNQA EKDSALGPES QDQSLHGHQS TVRLISTHTG TIGSLQYAEQ PDEVFGNRDV      1080
     EIEVHAAALN FKDLAHALGF IASNERRLGL ECTGIVTRRG NDARSVSVGD RVLLIRKDGG      1140
     GFGNRVISTV EGVQRIPDWM SFEDASTLGV CFMTTIYSLI DLANTQPGQT VLIHAGAGGV      1200
     GLAAIQICRY LQAEIYVTVG SEEKRRFLRT EYGIPEDRMF SSGSISFATD LMRATNGRGA      1260
     DVILNSLTGD MLHESWRCLA PNGNFIEIGK KDLLDRNSIS LAPFSHNASY RSFDLSLKAV      1320
     SLPTFDRLLK QIFAFVNDGI TKPLPICKTF SFGDIADAFR YMRDGKHIGK IVVSDENRDD      1380
     VRVPIIPAIP VLKLRDDVSY LIAGGFKGLC GSLALYLSRV GAKNIAVMSR SGYDDPASQS      1440
     IIYHLKAMRT HVDLIRGDIT DIEDVRRAFA STKKPVGGII QGAMVLRDKM FSRMTPDEFR      1500
     MPIDPKVVGT WNLHNLAIEH NLKLDFFTLL SSVSGVVGQR AQANYSAGNV FQDSFAVYRH      1560
     SLGLPACSVN LGVIEDVGYF TDRDNLSRRL ESQGWTPINE ALLHKILRFS ILQQTGSPIN      1620
     PDTVSLRRGP PGLLTSAVEV VDAVLMRSLG LKTPLEVSRP LASYGIDSLV AVELRNWTRS      1680
     ELGIETSALD IVGAKTLVSL CELILKRLLA                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page