(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE405

PENCW_13.PE405       Location/Qualifiers
FT   CDS             922724..923455
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947722"
FT                   /orf_name="Pc16g04050"
FT                   /product="Pc16g04050 protein"
FT                   /protein_id="CAP93075.1"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="UniParc:UPI0001831403"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H1"
FT                   /transl_table=1
FT                   /translation="MYDPRTTGLSDGEPRNNIDPFTQTDDYSDALSFLAVHPMVDQARM
FT                   GIWGMSLSGAVALACAAVDPRARFVVAVCPASEYSFAQAKIPSVLGKIAKDRESQLKGN
FT                   VPFYLPMLNRAGENPAGFNLGVDKDAALRILSAQDEKNPTRQALAANHVNRTTIQSYRK
FT                   LLMWSPAPIYRHLAVPVMFVVPELDQLISAARQQETFENLPGTTNQLHVEHGVGHMDVL
FT                   EGEQLPDLMKRKLLFIQGVVG"
     MYDPRTTGLS DGEPRNNIDP FTQTDDYSDA LSFLAVHPMV DQARMGIWGM SLSGAVALAC        60
     AAVDPRARFV VAVCPASEYS FAQAKIPSVL GKIAKDRESQ LKGNVPFYLP MLNRAGENPA       120
     GFNLGVDKDA ALRILSAQDE KNPTRQALAA NHVNRTTIQS YRKLLMWSPA PIYRHLAVPV       180
     MFVVPELDQL ISAARQQETF ENLPGTTNQL HVEHGVGHMD VLEGEQLPDL MKRKLLFIQG       240
     VVG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page