(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE406

PENCW_13.PE406       Location/Qualifiers
FT   CDS             join(923691..924232,924414..925371,925422..925535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947723"
FT                   /orf_name="Pc16g04060"
FT                   /product="Pc16g04060 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93076.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831404"
FT                   /db_xref="UniProtKB/TrEMBL:B6H867"
FT                   /transl_table=1
FT                   /translation="MKMDPIPSHPESSPNSPTPTSDRSFLQTFTILTALCAGVFVAALD
FT                   VTIITTALPSIAAHFESSSAYTWIGSSYILANTATIPAWGKVSDIWGRKPLLLVATVIF
FT                   FSGSLICAVGNTIAIFLFGRAVQGLGAAGLITLVNICVSDLFSLRDRGLYFGLISVVWA
FT                   LASGVGPVLGGVFTEKASWRWCFWVNLPVTGLVFLLLWLTLKLESPDTPIWSGLKAVDW
FT                   TGCLFVIGSTIMLLLGLDFGGVSHPWNSATVICLIIFAGVLLGLFVVNEWRLAKYPVIP
FT                   LVLFHHRSGIASFLVCFCHGYIFMGEAYYLPLYFQAVLSSSPIMSGVYIIPFVLALTVS
FT                   AALTGFFIQKTGVYVPAMWSGLAAMTLGVGLLINLEVTANWGKIMGFQVIAGIGIGMNF
FT                   EGPLLALQAIVGSENTATATATIGFVRTLSTAISVVIGTVVFQNQMARKESQLVSTLGQ
FT                   QLASQVSRDAMANIKVIDTLPLDQKLVARQAIYGSLQTVWIMYVAFAAVGLVAGVFVEG
FT                   HHLDTEHKAPVLGLRDDNEG"
     MKMDPIPSHP ESSPNSPTPT SDRSFLQTFT ILTALCAGVF VAALDVTIIT TALPSIAAHF        60
     ESSSAYTWIG SSYILANTAT IPAWGKVSDI WGRKPLLLVA TVIFFSGSLI CAVGNTIAIF       120
     LFGRAVQGLG AAGLITLVNI CVSDLFSLRD RGLYFGLISV VWALASGVGP VLGGVFTEKA       180
     SWRWCFWVNL PVTGLVFLLL WLTLKLESPD TPIWSGLKAV DWTGCLFVIG STIMLLLGLD       240
     FGGVSHPWNS ATVICLIIFA GVLLGLFVVN EWRLAKYPVI PLVLFHHRSG IASFLVCFCH       300
     GYIFMGEAYY LPLYFQAVLS SSPIMSGVYI IPFVLALTVS AALTGFFIQK TGVYVPAMWS       360
     GLAAMTLGVG LLINLEVTAN WGKIMGFQVI AGIGIGMNFE GPLLALQAIV GSENTATATA       420
     TIGFVRTLST AISVVIGTVV FQNQMARKES QLVSTLGQQL ASQVSRDAMA NIKVIDTLPL       480
     DQKLVARQAI YGSLQTVWIM YVAFAAVGLV AGVFVEGHHL DTEHKAPVLG LRDDNEG          537
//

If you have problems or comments...

PBIL Back to PBIL home page