(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE407

PENCW_13.PE407       Location/Qualifiers
FT   CDS             complement(925609..926549)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947724"
FT                   /orf_name="Pc16g04070"
FT                   /product="Pc16g04070 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP93077.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00018314E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H868"
FT                   /transl_table=1
FT                   /translation="MASEASTSANGGSLAAMLEQQHARDEAHKATVEETVDEEDLKHPP
FT                   PTSLQPEEPLLVNSDTSEPTTIAQTASPTPSPKPPTKKAPTFDVQSEELFPALGSGPKP
FT                   AAPAAATWGAKKPSAAATVANGSPASQWVRGLFWSPPGVGQISDTGTEIPRIMALPGKH
FT                   MEQLRLAPSQMQPRGQMKKPLRDILRDISRRSKANVDMRGGPGGSIIFEGKGSVDAVRQ
FT                   ALREVAQQQSVRVPIPTSARAHIIGRQGTVVQDIQTRTGARVQVPRADGNAADDDDDDT
FT                   IDILIEGDAVAAEMARREIEAIVKERGSNMSFRLKTVPPEFFPFIAGAHDANLRAIEER
FT                   TKAQINVPRYDTWSTQPPPQEANPGQVQFVAVPDKHILISGERAAAQEARAEIERLAAQ
FT                   LRQQLTLRQLAINRGQHQFILGNEPDALHQFVAQTGCAIVLPPSSDESEFLTITGPVDQ
FT                   IEAGIEHAMDLATSMQMASIDLSRQHPNAPAGPHAHASALSQYLRRRQVIKELESTYDA
FT                   HIALPPSVGGPVTWEVYSRDGKNTIRARSDIMNLVQALPPSRLRHVSVDPYFHQYLRDR
FT                   SATTLQGDYGVHLMVPDDVNCPEVVLVYEGPSSTASSFEVPRQRPSPADVAAFEKGLQE
FT                   AQEYLLGALGDQRDIVAKSVSVPAKYQEKARKFINREQEAKGEDSIPVRAIVGDAKGSQ
FT                   CQVSLRGPSGLVAELAAKVEAFVVEQEKDDLERGYTTSFDFPQKYANFLIGKRGENINK
FT                   LREEFDVDIKVENGKVEVKGPKAKADATRMRIINMGKKLEDETTHILKVPAQYHRELIG
FT                   QRGNQVNRLQDRYSVRVQFPRATVPNDDATETGSDAGGARPQRAQQAPDEVLVKGPSKG
FT                   ADSARDEILSLLQYVIEHGHSASISVAQSQVASLIGQRGREMEKLRADTGAQIDVPNAN
FT                   DAPDASGRVEIRVKGTKQQVAEAKKILQQRASEFDATVTKTIEVEKKYHKALIGGGGAN
FT                   IRKIVTEAGGPTDGSAARMVRFPRPESTESTIRLEGNGKIVDNIIAAIEEFVKERQDQV
FT                   TEILDVPTAQHRMLIGRGGEARRGIETKFNVTLDIPKQGSGRTDVKLKGPSSAVQSAKE
FT                   HIQSMLKEQHAETIEVPSHLHHFLADNGQIFRRLRNDYQVTVDHAGQAVPVPAPSAAED
FT                   TRTTAEGTDMPLIIDDPNVTADAHSWTVVDNNATEVPSSPFPWVLSGTPENVAKARAVI
FT                   EKNLASATQQSTTGYLILPDPKTYRFVVGQGGSQINAIRKKTGCRINVPKEQARGEAIE
FT                   IRGSPSGLEEAKEMILEAVQNGLHPSAR"
     MNSLKSFWTQ YFPPSPTSSE SQVGPQLLRV FVVTGGNSGL GLELVKRLYP TGATIYLACR        60
     SKERAEIAMQ KVIESTNESY ISTPPKLKFL YLDLNDLSSI AKSAATFCKN ESRLDILWNN       120
     AGIGGSPIGT TTRQGLEGHI GVNCVGPLMF TQALLPMLRN AAQDSAPEVC GSFGLPVXVS       180
     SHMLLLGALG QIEWIAGSRK ILLATTLNQR SETGGWRXKV RDGMQSTELX ALPKTRDSWI       240
     QMCGSISHGG XXFWCDPHCM IRDSESIRCC TQGSPKFCWL EINDTXFHGA EXESGMNVRR       300
     GILXRLWMIW VRN                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page