(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE408

PENCW_13.PE408       Location/Qualifiers
FT   CDS             join(927092..927273,927413..927840,927888..928419,
FT                   928475..929192,929244..929348,929401..929930)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947725"
FT                   /orf_name="Pc16g04080"
FT                   /product="Pc16g04080 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP93078.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00018314E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H869"
FT                   /transl_table=1
FT                   /translation="MAVVSTLKLPSQGLGDPVLLDKIDQLLACNLAGYVNLPQLVVVGD
FT                   QSSGKSSVLEGLTKLPFPRDSGLCTRFATHIIFRRTRADTKRSISASIVPAYGKPAEHA
FT                   SRLGAWKATHMESLDSESFASTMREVHETMGLSRSREESSKPTFTLDVFRLDICGPEED
FT                   NLSIIDVPGIFKNTTHGLTTKQDMDLVKDMVLSYMRNPRSIMLTVIPANVDIATQEILE
FT                   MARECDPEGSRTQGVFTKPDLVDKGAEDKVIDLVEGKTSSLKLGWIVVRNAGQQQLLDQ
FT                   DSNRDEVESQFFREAHPWNNLPKDKVGIASLKIRLQEVQTTQILESFPRHMRAEVGRKL
FT                   KAMKQDLSALGIERSTPEQQRNFLLDIIVKFQNIVSQAMATSYGTHELFEKDEDTRLAT
FT                   IVRNRMDVFKSDMEEYGFEYQFLNWAPALHAGVGPVPEPESGSGDDSDDDDDEEADGIP
FT                   VRKNMNTSEHSGAIDGILHEQVNVRKPRGGSILAWIEDQYRASRGFELGTFQTALLCTI
FT                   MNKQSDKWTELALGYVSDVIDIMHTFILKVLLSICPDEQIRDKLLNVLVDELSKRYRAA
FT                   MDQAQMILEVERMNLMTLDDKFQQTLDIAQKRRCVRLIHSISGEDTILNYFTSHQEQYE
FT                   IVKGKEKVPMSNTQQTVRYIHDILAAYYAVASKRFIDSICMQATGYCLLTGPRKPPGLF
FT                   SPQFVADLAEDQLMEIAGENARLSRRRVQLKKGIQDLETGRKIMM"
     MGVRHISLFL ANILLPAAVI LFGCGLFSSE PTGIITPYAY KEKAPPLFDK VVFMVIDALR        60
     SSFSLIRSGS AIPFTAHANP PSLTISCIKA MTIGSNPSFL DVALNIADND DASNLSSEDT       120
     WLQGLKAPLA ERXYSTAKTR GCSCTRTFLI GVRVLTHSSC QTLLKSTIML QFMSLQNXLV       180
     KTGPHWYFTS QEWTISAIPA DQRVPIYFGS NKRWTLSSVR YIQPSNPSLI SVRPSSSXLA       240
     TMAXTNKGIT VDLPRVKSPQ GCSXFLLIXN RSLATEKLQL PLMAQDLTFI LSLNNLISSP       300
     RWPVCSAFES LARAREFSCH NSSPFGKTHL IVYGYYXRTL INYXMLGDTM SITRITSLFK       360
     ELKIELFRIQ AQRKPCRNYT SGVIKCRTHW AWQLEVXTFV CSPQAFXAQS ALASYASVSS       420
     SMGTSKSNTW LCQRYLPQST PELCFPRNMS RKNITSGTRS LXSGLAILAT LGTVTAALSI       480
     VRFQSXCNFW FCPGRKVEMQ PICCQKYFRR SFPGTPXSSG XCXVGLMFPL PSGCMDHWEV       540
     HVAPPSFPKY GLRLSAPWHS YXSSVLLLSI PLTXLDSPLR ISFTGXRRXI XTPLPNWSSQ       600
     YWRALWFTCX HXRANVNERK NLPAFIMSSP FTXWRSPDLG IFLCSWFSNG SXNGXFXHPQ       660
     LILSSRLLCP PSSCPKALSL HLVVATPSLR SIXQMATMVS RLTIQLRWYC RRFSPIGQVL       720
     SGGPAREXGY SRSPFTTEHL KSYLRRKAIR KTRRGSESPV QHXWLIWLFR HCLFPSVLLL       780
     SWLHVLFFGI HPXSGQLXLP SIFSPVYGWS SITCLSPLDY LVLLEKQYLR I                831
//

If you have problems or comments...

PBIL Back to PBIL home page