(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE409

PENCW_13.PE409       Location/Qualifiers
FT   CDS             join(complement(931075..931226),complement(930572..930995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824351"
FT                   /orf_name="Pc16g04090"
FT                   /product="Pc16g04090 protein"
FT                   /protein_id="CAP93079.1"
FT                   /db_xref="UniParc:UPI00018314EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H870"
FT                   /transl_table=1
FT                   /translation="MSLLRKPMKQYNWLPDYMQNIYQWLYYCEPTWGYTIYRTTYTPQS
FT                   NAAFPAANEFNITPWDEIWPNYQPRVIEDASRFDGASIDQLRKHFRADAIERDMLDVFP
FT                   SYRMFIVIDEESFQTLRNAPFPENSKYEERRYHYVKLVEALEVDLSEDFQGWMKCSLPS
FT                   LWEIWSDMQDTTYMKDTSSMIPDDTDVL"
     MSLLRKPMKQ YNWLPDYMQN IYQWLYYCEP TWGYTIYRTT YTPQSNAAFP AANEFNITPW        60
     DEIWPNYQPR VIEDASRFDG ASIDQLRKHF RADAIERDML DVFPSYRMFI VIDEESFQTL       120
     RNAPFPENSK YEERRYHYVK LVEALEVDLS EDFQGWMKCS LPSLWEIWSD MQDTTYMKDT       180
     SSMIPDDTDV L                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page