(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE410

PENCW_13.PE410       Location/Qualifiers
FT   CDS             join(931746..932170,932259..932895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128692"
FT                   /orf_name="Pc16g04100"
FT                   /product="Pc16g04100 protein"
FT                   /biological_process="mitochondrial proton-transporting ATP
FT                   synthase complex assembly"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93080.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0033615"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniParc:UPI00018314EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H871"
FT                   /transl_table=1
FT                   /translation="MWKYTLSTLVADLPLLQTGRCLSCQFRNPATLSQLRTKPFSLRQY
FT                   SNKPGKPIDAKETPPVKRNLKNEAHRLSTAIEFKQNQPQDGPQPGDADFVPPSLDRPIG
FT                   SPQAPLEGQNTGIDTRSMRQRRDDFTNYDRHIKRRKELTKQVAKPYFREWSNLRFAEGK
FT                   TFVSNPRLFKADRALYFPNMHGITLASPKDPQNTTTQLRGSISVVNLFSSVWAESQVAT
FT                   FTGPEQNPGLVEAMASGGKLVQRIDINLEENRLKAFLVKTFMWRMRQKLAKEQHSRYFL
FT                   VQKGFDQALKETVGMMNSKVGYVYLVDSECRIRWAGSGPAEKSELEGLNAGVRKLIEEK
FT                   KNVLRVHDPSRGY"
     MWKYTLSTLV ADLPLLQTGR CLSCQFRNPA TLSQLRTKPF SLRQYSNKPG KPIDAKETPP        60
     VKRNLKNEAH RLSTAIEFKQ NQPQDGPQPG DADFVPPSLD RPIGSPQAPL EGQNTGIDTR       120
     SMRQRRDDFT NYDRHIKRRK ELTKQVAKPY FREWSNLRFA EGKTFVSNPR LFKADRALYF       180
     PNMHGITLAS PKDPQNTTTQ LRGSISVVNL FSSVWAESQV ATFTGPEQNP GLVEAMASGG       240
     KLVQRIDINL EENRLKAFLV KTFMWRMRQK LAKEQHSRYF LVQKGFDQAL KETVGMMNSK       300
     VGYVYLVDSE CRIRWAGSGP AEKSELEGLN AGVRKLIEEK KNVLRVHDPS RGY              353
//

If you have problems or comments...

PBIL Back to PBIL home page