(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE411

PENCW_13.PE411       Location/Qualifiers
FT   CDS             join(complement(933952..934017),complement(933782..933895),
FT                   complement(933211..933714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824352"
FT                   /orf_name="Pc16g04110"
FT                   /product="Pc16g04110 protein"
FT                   /protein_id="CAP93081.1"
FT                   /db_xref="UniParc:UPI00018314EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H872"
FT                   /transl_table=1
FT                   /translation="MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPPSPTE
FT                   EELRLESQLKDLLERRESVIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQR
FT                   LTAAISESRDRANLLSNVRSDISSYRASNPAAAEAEYMLEERGRVENSHSMMDGVLSQA
FT                   YAINENFGVQSETIANINRRIVGAAGNVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLM
FT                   LLFFR"
     MASSTSSGWT QLRQQARSLE TQTENLFHTY SQFASITKPP PSPTEEELRL ESQLKDLLER        60
     RESVIAQLSR LLDSEATLTS SALKQNNVSR HREVLQDHRR ELQRLTAAIS ESRDRANLLS       120
     NVRSDISSYR ASNPAAAEAE YMLEERGRVE NSHSMMDGVL SQAYAINENF GVQSETIANI       180
     NRRIVGAAGN VPGMNYLIGK IGNKKRRDAI ILGCFIGFCF LMLLFFR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page