(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE412

PENCW_13.PE412       Location/Qualifiers
FT   CDS             join(934381..934383,934446..934585,934815..935046)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947726"
FT                   /orf_name="Pc16g04120"
FT                   /product="Pc16g04120 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP93082.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniParc:UPI00018314ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H873"
FT                   /transl_table=1
FT                   /translation="MSSKVKAGQLWGKNKDELATQLEELKLELNQLRVQKIASGASSKT
FT                   QRIGEVRKSIARVLTVINANQRAQLRLFYKNKKYLPLDLRPKLTREIRRRLTKHERTQT
FT                   TDKLRKRAIHFPQRKYAVKV"
     MSSKVKAGQL WGKNKDELAT QLEELKLELN QLRVQKIASG ASSKTQRIGE VRKSIARVLT        60
     VINANQRAQL RLFYKNKKYL PLDLRPKLTR EIRRRLTKHE RTQTTDKLRK RAIHFPQRKY       120
     AVKV                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page