(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE416

PENCW_13.PE416       Location/Qualifiers
FT   CDS             join(complement(946179..946200),complement(946020..946114),
FT                   complement(944447..945958))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671670"
FT                   /orf_name="Pc16g04160"
FT                   /product="Pc16g04160 protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93086.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00018314F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E8"
FT                   /transl_table=1
FT                   /translation="MVTKSGFGKTSKRVPVRLRHKIEKSAVQKQRKQRKLAKKNPEWRS
FT                   KIKKDPGIPNLFPNKDKLLHDIEERKRIKAEEQQRIREEARARKAEGLPAKAGTEAVDI
FT                   DENDMMDDDMDAEGNDSNPMAALLASARARAVEYDDNQSEDEDMEEDEDDDDDEMDEDE
FT                   EEGGATIDESAPPLVNSKSYSKESSRRQFDKVFKQVTDNADVVLYVLDARDPEGTRSKD
FT                   IEREIMMADGGNKRLILILNKIDLVPPPVLKGWLLHLRRSFPTLPLKASSGTTANAHSF
FT                   DHKQLTVKGTSDTLFRALKSYAGAKQLKRAISVGVIGYPNVGKSSVINALTARLNKGSS
FT                   NACPTGAEAGVTTSLRQVKLDSRLKLIDSPGIVFPSSSDKSGKKNKKQEEQARLILLNA
FT                   VPPKQIEDPVPAVNLLMKRLSSSENLLAKMLELYGITALFPTNGDKTTDFLVQVARKRG
FT                   RLGKRGVPNIESAAMTVINDWRDGRIQGWANAPVLPVVSADAPAGDVEAGVDTTKVAVV
FT                   TEWAKEFSIEGLWGNGQGDDEEMAE"
     MVTKSGFGKT SKRVPVRLRH KIEKSAVQKQ RKQRKLAKKN PEWRSKIKKD PGIPNLFPNK        60
     DKLLHDIEER KRIKAEEQQR IREEARARKA EGLPAKAGTE AVDIDENDMM DDDMDAEGND       120
     SNPMAALLAS ARARAVEYDD NQSEDEDMEE DEDDDDDEMD EDEEEGGATI DESAPPLVNS       180
     KSYSKESSRR QFDKVFKQVT DNADVVLYVL DARDPEGTRS KDIEREIMMA DGGNKRLILI       240
     LNKIDLVPPP VLKGWLLHLR RSFPTLPLKA SSGTTANAHS FDHKQLTVKG TSDTLFRALK       300
     SYAGAKQLKR AISVGVIGYP NVGKSSVINA LTARLNKGSS NACPTGAEAG VTTSLRQVKL       360
     DSRLKLIDSP GIVFPSSSDK SGKKNKKQEE QARLILLNAV PPKQIEDPVP AVNLLMKRLS       420
     SSENLLAKML ELYGITALFP TNGDKTTDFL VQVARKRGRL GKRGVPNIES AAMTVINDWR       480
     DGRIQGWANA PVLPVVSADA PAGDVEAGVD TTKVAVVTEW AKEFSIEGLW GNGQGDDEEM       540
     AE                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page