(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE417

PENCW_13.PE417       Location/Qualifiers
FT   CDS             join(946589..946688,946766..946787,946853..946962,
FT                   947030..947511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947730"
FT                   /orf_name="Pc16g04170"
FT                   /product="Pc16g04170 protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="CAP93087.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018314F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E9"
FT                   /transl_table=1
FT                   /translation="MSSTTGSFSAPTQVHTFDGLLSDFDGTIVDSTDAIVKHWHKIGDE
FT                   LGVDPKVILATSHGRRSIDVMGLYDQTKANWDYVNEIEGRIPKEFGTDAVEIPGGRDLI
FT                   AALETSGARWGVVTSGTRPLVDGWLEVLGLPHPKNLVTAMDVPLGKPDPRCYLLGRKQL
FT                   GIEESTSIVVLEDAPSGIKAGKAAGFKVIALTTTHSLQKLQEAGADWIVEDLRSLSVKA
FT                   VVDGQVQIEIRNAYQ"
     MSSTTGSFSA PTQVHTFDGL LSDFDGTIVD STDAIVKHWH KIGDELGVDP KVILATSHGR        60
     RSIDVMGLYD QTKANWDYVN EIEGRIPKEF GTDAVEIPGG RDLIAALETS GARWGVVTSG       120
     TRPLVDGWLE VLGLPHPKNL VTAMDVPLGK PDPRCYLLGR KQLGIEESTS IVVLEDAPSG       180
     IKAGKAAGFK VIALTTTHSL QKLQEAGADW IVEDLRSLSV KAVVDGQVQI EIRNAYQ          237
//

If you have problems or comments...

PBIL Back to PBIL home page