(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE418

PENCW_13.PE418       Location/Qualifiers
FT   CDS             join(947783..947843,947951..948073,948149..948200,
FT                   948246..948501,948573..948905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977577"
FT                   /orf_name="Pc16g04180"
FT                   /product="Putative uncharacterized protein Pc16g04180 "
FT                   /protein_id="CAP93088.1"
FT                   /db_xref="UniParc:UPI00018314F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F0"
FT                   /transl_table=1
FT                   /translation="MSTVWSYSWKLRTVATGAENAGLDAPRPQALGSAYPEMVKGYKVL
FT                   KQLSWFPGRGCNRTRQGMEFTAALHTDRRMTADSCIAVDTVTGRPRAPWHAWRTPFVGM
FT                   QLRNPCSSKPDFFDRALQHATVPATHIWSNHLGRAGRELPFMHAWDMEPDREHGNVSPE
FT                   KLYGGETTAAAASSFGKGVRCSRGYGYSFVPATLEQQHSADVIGGSSGLGDGHILPDWG
FT                   SLGRERMFSPMVLRKATRPVRTACKGATLHPAHESREEVMFECRLLNIVTID"
     MSTVWSYSWK LRTVATGAEN AGLDAPRPQA LGSAYPEMVK GYKVLKQLSW FPGRGCNRTR        60
     QGMEFTAALH TDRRMTADSC IAVDTVTGRP RAPWHAWRTP FVGMQLRNPC SSKPDFFDRA       120
     LQHATVPATH IWSNHLGRAG RELPFMHAWD MEPDREHGNV SPEKLYGGET TAAAASSFGK       180
     GVRCSRGYGY SFVPATLEQQ HSADVIGGSS GLGDGHILPD WGSLGRERMF SPMVLRKATR       240
     PVRTACKGAT LHPAHESREE VMFECRLLNI VTID                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page