(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE419

PENCW_13.PE419       Location/Qualifiers
FT   CDS             join(complement(949994..950152),complement(949722..949814),
FT                   complement(949038..949391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947731"
FT                   /orf_name="Pc16g04190"
FT                   /product="Putative uncharacterized protein Pc16g04190 "
FT                   /protein_id="CAP93089.1"
FT                   /db_xref="UniParc:UPI00018314F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F1"
FT                   /transl_table=1
FT                   /translation="MTPPFGRLCSLSSWHIMPHQPTHKMVSWSKVMARTVLRTEYIIGK
FT                   CERHGHGPVVQHPWIGTPYFVKIRGIGGSAMTTPGSIRNPGYFRRPEYFGQKSQVAELC
FT                   RSINVIDPRGHPRVSLVALRKGLWRCATISSALHITLEFRICQFRGASAPAGRIIHRTR
FT                   HKGTVYNMIGRAIQPGASPWAWSRSELGKRMRTQPAVM"
     MTPPFGRLCS LSSWHIMPHQ PTHKMVSWSK VMARTVLRTE YIIGKCERHG HGPVVQHPWI        60
     GTPYFVKIRG IGGSAMTTPG SIRNPGYFRR PEYFGQKSQV AELCRSINVI DPRGHPRVSL       120
     VALRKGLWRC ATISSALHIT LEFRICQFRG ASAPAGRIIH RTRHKGTVYN MIGRAIQPGA       180
     SPWAWSRSEL GKRMRTQPAV M                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page