(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE42

PENCW_13.PE42        Location/Qualifiers
FT   CDS             join(93753..93767,94044..94208,94371..94586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945519"
FT                   /orf_name="Pc16g00420"
FT                   /product="Putative uncharacterized protein Pc16g00420 "
FT                   /protein_id="CAP92712.1"
FT                   /db_xref="UniParc:UPI0001831E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V3"
FT                   /transl_table=1
FT                   /translation="MASGQDKMQNHDYRTPTSRRLGVRYKISIAMRTLEELNVGAGYNS
FT                   FQKRIPKKASCKMAELRLGDTRFTYLFPSTSGGSVKVPPPEEAWPLIVRLVNVGFLDTG
FT                   RWPIGPFPPLKTYWHIPSSLTFLVYFS"
     MASGQDKMQN HDYRTPTSRR LGVRYKISIA MRTLEELNVG AGYNSFQKRI PKKASCKMAE        60
     LRLGDTRFTY LFPSTSGGSV KVPPPEEAWP LIVRLVNVGF LDTGRWPIGP FPPLKTYWHI       120
     PSSLTFLVYF S                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page