(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE420

PENCW_13.PE420       Location/Qualifiers
FT   CDS             join(complement(952854..952887),complement(952667..952761),
FT                   complement(952249..952318),complement(951440..951577),
FT                   complement(950606..950805))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947732"
FT                   /orf_name="Pc16g04200"
FT                   /product="Putative uncharacterized protein Pc16g04200 "
FT                   /protein_id="CAP93090.1"
FT                   /db_xref="UniParc:UPI00018314F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F2"
FT                   /transl_table=1
FT                   /translation="MEFGGAGGKIGDETILRRSVPILGTGYMRLMYYEYRDCGYLYSNR
FT                   VGPEHNSDPVQTPLVNPFHHGLFPRTGVTGDRCSGSGDRAQPGMIIQLYDSRIVMMMGN
FT                   DDVYSIYKEPLAAKIQDIWATNLERGVERSPNACLLIGTRRDPNSDLVDTWIVEPGENK
FT                   ATMNRCSGTSALAAR"
     MEFGGAGGKI GDETILRRSV PILGTGYMRL MYYEYRDCGY LYSNRVGPEH NSDPVQTPLV        60
     NPFHHGLFPR TGVTGDRCSG SGDRAQPGMI IQLYDSRIVM MMGNDDVYSI YKEPLAAKIQ       120
     DIWATNLERG VERSPNACLL IGTRRDPNSD LVDTWIVEPG ENKATMNRCS GTSALAAR         178
//

If you have problems or comments...

PBIL Back to PBIL home page