(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE421

PENCW_13.PE421       Location/Qualifiers
FT   CDS             join(953291..953620,953678..955510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977578"
FT                   /orf_name="Pc16g04210"
FT                   /product="Pc16g04210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93091.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI00018315E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F3"
FT                   /transl_table=1
FT                   /translation="MSYIHPSWNYQGHQGIPMDQHMAYDPSMVPPPMMHPIDGYMYPHP
FT                   PMEMIDYYHQPIMDYDEYTENLSRPRLTKEQVETLEAQFQAHPKPSSNVKRQLAAQTNL
FT                   SLPRVANWFQNRRAKAKQQKRQEEFEKMTKAKAEAEEAARRKSETLDQLSGSRKGSIAN
FT                   EESEKSATPKQTPTSTSSGHAKTDSTSSRSKHHKTKSESAREATFASLQRALNAACAAR
FT                   DRFGRRINPRSKNESVPEEDEEEEAVSPGSMPPPKAVTPANDHGNLANINSSFSGWSGI
FT                   KEEPASWGSAEHNDNVGYSTTEQTSYSTSCHQAMADISNPSHSMQQNLDVYSNHLPPHT
FT                   EEWSEDRESRHDNLVYSNMQYPMPMQAPDISVTRRESSSALTSSLEGIGICTTGQSGLS
FT                   QPVDRVEATWKEPGKELDLAARRKRPRPAAIGTSGTRPLANSTSMSSLSPTARMPSSGA
FT                   GNSMRQSKSTQSLNSRYAGVRKASAAQRSPLNFTFADSGSIKKAEKMLRPSISTTSLAP
FT                   PTPLTPQDLQHFMPASPTDSNYCLSAHSTAHFFPTSQPMQVNMASPPATPLDIYSPFPY
FT                   QNVAPPMSAPAQVSSFPEYLTCDSVPIPARSWADTGSISSPEYPAGLQVPHSSTVSPMG
FT                   YNATTDHTGQAFGMESVSGSPSLIYSIEDTDIPGSAELAERKRPEFMMHEFPEHDTHFG
FT                   GHHLSSMQKPKAYTFANNTTPSNYPS"
     MSYIHPSWNY QGHQGIPMDQ HMAYDPSMVP PPMMHPIDGY MYPHPPMEMI DYYHQPIMDY        60
     DEYTENLSRP RLTKEQVETL EAQFQAHPKP SSNVKRQLAA QTNLSLPRVA NWFQNRRAKA       120
     KQQKRQEEFE KMTKAKAEAE EAARRKSETL DQLSGSRKGS IANEESEKSA TPKQTPTSTS       180
     SGHAKTDSTS SRSKHHKTKS ESAREATFAS LQRALNAACA ARDRFGRRIN PRSKNESVPE       240
     EDEEEEAVSP GSMPPPKAVT PANDHGNLAN INSSFSGWSG IKEEPASWGS AEHNDNVGYS       300
     TTEQTSYSTS CHQAMADISN PSHSMQQNLD VYSNHLPPHT EEWSEDRESR HDNLVYSNMQ       360
     YPMPMQAPDI SVTRRESSSA LTSSLEGIGI CTTGQSGLSQ PVDRVEATWK EPGKELDLAA       420
     RRKRPRPAAI GTSGTRPLAN STSMSSLSPT ARMPSSGAGN SMRQSKSTQS LNSRYAGVRK       480
     ASAAQRSPLN FTFADSGSIK KAEKMLRPSI STTSLAPPTP LTPQDLQHFM PASPTDSNYC       540
     LSAHSTAHFF PTSQPMQVNM ASPPATPLDI YSPFPYQNVA PPMSAPAQVS SFPEYLTCDS       600
     VPIPARSWAD TGSISSPEYP AGLQVPHSST VSPMGYNATT DHTGQAFGME SVSGSPSLIY       660
     SIEDTDIPGS AELAERKRPE FMMHEFPEHD THFGGHHLSS MQKPKAYTFA NNTTPSNYPS       720
//

If you have problems or comments...

PBIL Back to PBIL home page