(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE422

PENCW_13.PE422       Location/Qualifiers
FT   CDS             join(956487..956618,956725..956943,957002..957721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977579"
FT                   /orf_name="Pc16g04220"
FT                   /product="Pc16g04220 protein"
FT                   /protein_id="CAP93092.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00018315E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F4"
FT                   /transl_table=1
FT                   /translation="MRLSTLGSALVGLAVAQASTINYTTVTGYFLQDEESTDPTTFDYT
FT                   AENFGLIGRAYPADKEHKKHGSLTQWERFYHQVTKLNEHSPKHVEYKVLFLGRHGEGWH
FT                   NAAESYYGTPAWNCYWSELNGNSTASWADSDLTPGGISQALKANEFWQKEINEQRIHTP
FT                   DHYYVSPMTRALKTANLTFTGLDMPKHSAAFKPTVKELFREGISVHTCDHRRSRSYIHD
FT                   LFPHWPIEHGFTEEDELWNGVTAEPSGAQDVRSAQALGDVFFTSSKKKSFVSITSHSGE
FT                   ISSILRVIGHRTFKLSTGAVIPVLVKAEKVDEEPATSSVSWEVSPHCTEPPVTSVTACV
FT                   CPSSAVPVTTPLATGF"
     MRLSTLGSAL VGLAVAQAST INYTTVTGYF LQDEESTDPT TFDYTAENFG LIGRAYPADK        60
     EHKKHGSLTQ WERFYHQVTK LNEHSPKHVE YKVLFLGRHG EGWHNAAESY YGTPAWNCYW       120
     SELNGNSTAS WADSDLTPGG ISQALKANEF WQKEINEQRI HTPDHYYVSP MTRALKTANL       180
     TFTGLDMPKH SAAFKPTVKE LFREGISVHT CDHRRSRSYI HDLFPHWPIE HGFTEEDELW       240
     NGVTAEPSGA QDVRSAQALG DVFFTSSKKK SFVSITSHSG EISSILRVIG HRTFKLSTGA       300
     VIPVLVKAEK VDEEPATSSV SWEVSPHCTE PPVTSVTACV CPSSAVPVTT PLATGF           356
//

If you have problems or comments...

PBIL Back to PBIL home page