(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE423

PENCW_13.PE423       Location/Qualifiers
FT   CDS             join(959757..960176,960241..961452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947733"
FT                   /orf_name="Pc16g04230"
FT                   /product="Putative uncharacterized protein Pc16g04230 "
FT                   /protein_id="CAP93093.1"
FT                   /db_xref="UniParc:UPI00018315E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L0"
FT                   /transl_table=1
FT                   /translation="MDPSETQSPPSSRLSAMVLSSSPSDPLAVMASNCSPSEQLSAMIL
FT                   NSSPTQQAPPDASRDAPRDAPTKAPSSRASLFGNGRPSRTPSPPGTPSPLDRRISNKLN
FT                   RSPSRAHRVDALSDQTSGDFPYLAREPSLPYEAWENVFYAMLATYSYEEYDFTYGDVFE
FT                   QPETKKTLSTLRLVNRIWNRIATPLLFRNIQAVVGYSAGRPLDSILRISESPYALYVRD
FT                   VRFGFVGSWLPGLDYDRYIDDLAAGALPILISRFQNIQTLRLQTPTVIDTFSEEGQLKP
FT                   AMLAKLTNALVHTLRLVSVPILKCLHISMPTTAEFARFFESNSYTGGFTNIFGQLEELH
FT                   ITINDSTGPDGRRDPKWPRSVIKTKYPPDRFAPYLIQLIAYARRIQVFSLDARTWFDVS
FT                   DLEAESFTKLKSFRLEGVRINHKTLRQIFIEARDTLHRIQLVHVRLMSGTWQEVFDHSA
FT                   LPPKDLSWLYVHGCGYSMTGASARYMGSTFSRYPTALWTRYAPDWLAITHWRTVVNTNR
FT                   QRRSLPICPYCYYPSIEPILRDLGSN"
     MDPSETQSPP SSRLSAMVLS SSPSDPLAVM ASNCSPSEQL SAMILNSSPT QQAPPDASRD        60
     APRDAPTKAP SSRASLFGNG RPSRTPSPPG TPSPLDRRIS NKLNRSPSRA HRVDALSDQT       120
     SGDFPYLARE PSLPYEAWEN VFYAMLATYS YEEYDFTYGD VFEQPETKKT LSTLRLVNRI       180
     WNRIATPLLF RNIQAVVGYS AGRPLDSILR ISESPYALYV RDVRFGFVGS WLPGLDYDRY       240
     IDDLAAGALP ILISRFQNIQ TLRLQTPTVI DTFSEEGQLK PAMLAKLTNA LVHTLRLVSV       300
     PILKCLHISM PTTAEFARFF ESNSYTGGFT NIFGQLEELH ITINDSTGPD GRRDPKWPRS       360
     VIKTKYPPDR FAPYLIQLIA YARRIQVFSL DARTWFDVSD LEAESFTKLK SFRLEGVRIN       420
     HKTLRQIFIE ARDTLHRIQL VHVRLMSGTW QEVFDHSALP PKDLSWLYVH GCGYSMTGAS       480
     ARYMGSTFSR YPTALWTRYA PDWLAITHWR TVVNTNRQRR SLPICPYCYY PSIEPILRDL       540
     GSN                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page