(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE424

PENCW_13.PE424       Location/Qualifiers
FT   CDS             join(complement(966869..966932),complement(966568..966681),
FT                   complement(964539..966427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977580"
FT                   /orf_name="Pc16g04240"
FT                   /product="Pc16g04240 protein"
FT                   /protein_id="CAP93094.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI00018315E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L1"
FT                   /transl_table=1
FT                   /translation="MNGMDIIDGSGTIDPANLSNSVSVALPAHSHAIASPRGVKRSRTP
FT                   DRMGNGRGQGGQDDEEQSRRKRGRPPKTPRPSSSDQAIANTSVQTPQMQARPLSQATAG
FT                   SPSLASPDSKGTPTKALVKALPTVRDHTSDQLNEEGDEYIPKEFDEAGETKADPMGYPL
FT                   GGREYKCRTFRVPLRGRKLFMLATECARVLNYRDSYLLFNKNRSLHKIIASQIEKDDLI
FT                   QQDILPYSYRSRQIAIVSARSMFRQFGSRVIVNGRRVRDDYWESKARKQGFTEDDLAGE
FT                   KRPGAAKARDGSVSEPATNMLPALPHNDVVYSNAIEPLPHGLSLDTSESSLSLAPVPMI
FT                   QMSTTDDPRLRDYTVMPRARQELTGQAYHDRTQTSSAADLMNQAQHTSDFNKMLSIQRS
FT                   FRQKGLDEFYSKPREAPVSETQSNTALESGLSVSQPVQVSQMPSAGMPNPAHTQHMLPQ
FT                   QVPMQPNPMMAGQPNYPQQPHPQSVGQAPLRIPPNMQPNLMQQRSNPSMGGGMGQAPPY
FT                   GYTPQQQQIWGQPPPQPQPSPLPSSGHHGVGMAQYGQQMSAGPQQSPSPLGHHPQQQHP
FT                   QQSPRNQQRQSIPQMPQQYSQMQHPQAPQTQGMQGMGYPGANPAGYPSVARAMYPPNQS
FT                   QPFMGGNPQQAGIAMNMAGNGMPGWPAGPGGPMQPGQPQPGQSGSPLGGGWSY"
     MNGMDIIDGS GTIDPANLSN SVSVALPAHS HAIASPRGVK RSRTPDRMGN GRGQGGQDDE        60
     EQSRRKRGRP PKTPRPSSSD QAIANTSVQT PQMQARPLSQ ATAGSPSLAS PDSKGTPTKA       120
     LVKALPTVRD HTSDQLNEEG DEYIPKEFDE AGETKADPMG YPLGGREYKC RTFRVPLRGR       180
     KLFMLATECA RVLNYRDSYL LFNKNRSLHK IIASQIEKDD LIQQDILPYS YRSRQIAIVS       240
     ARSMFRQFGS RVIVNGRRVR DDYWESKARK QGFTEDDLAG EKRPGAAKAR DGSVSEPATN       300
     MLPALPHNDV VYSNAIEPLP HGLSLDTSES SLSLAPVPMI QMSTTDDPRL RDYTVMPRAR       360
     QELTGQAYHD RTQTSSAADL MNQAQHTSDF NKMLSIQRSF RQKGLDEFYS KPREAPVSET       420
     QSNTALESGL SVSQPVQVSQ MPSAGMPNPA HTQHMLPQQV PMQPNPMMAG QPNYPQQPHP       480
     QSVGQAPLRI PPNMQPNLMQ QRSNPSMGGG MGQAPPYGYT PQQQQIWGQP PPQPQPSPLP       540
     SSGHHGVGMA QYGQQMSAGP QQSPSPLGHH PQQQHPQQSP RNQQRQSIPQ MPQQYSQMQH       600
     PQAPQTQGMQ GMGYPGANPA GYPSVARAMY PPNQSQPFMG GNPQQAGIAM NMAGNGMPGW       660
     PAGPGGPMQP GQPQPGQSGS PLGGGWSY                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page