(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE425

PENCW_13.PE425       Location/Qualifiers
FT   CDS             join(967000..967101,967143..967243,967655..967773,
FT                   967945..968006,968114..968215,968315..968452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947734"
FT                   /orf_name="Pc16g04250"
FT                   /product="Putative uncharacterized protein Pc16g04250 "
FT                   /protein_id="CAP93095.1"
FT                   /db_xref="UniParc:UPI00018315E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L2"
FT                   /transl_table=1
FT                   /translation="MARQVNAQGTRAEEEWKVAQESRGMLMQDFQTSKVGSRMNLGLRG
FT                   EGTRGGEDGSLRVQVFCKEDVHGLVILSRDRSDINRILATVKRIRSKWKRREWGSFCDV
FT                   LVAAIESSIWIEKHGEGPCVFWATESTTLFGFETPNYRYSGRNTRSTQGTVHIGANHET
FT                   MGRVYGRTNNFVWNVPEWRFFLFRFRARSITTRVGVPDTVTDSG"
     MARQVNAQGT RAEEEWKVAQ ESRGMLMQDF QTSKVGSRMN LGLRGEGTRG GEDGSLRVQV        60
     FCKEDVHGLV ILSRDRSDIN RILATVKRIR SKWKRREWGS FCDVLVAAIE SSIWIEKHGE       120
     GPCVFWATES TTLFGFETPN YRYSGRNTRS TQGTVHIGAN HETMGRVYGR TNNFVWNVPE       180
     WRFFLFRFRA RSITTRVGVP DTVTDSG                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page