(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE429

PENCW_13.PE429       Location/Qualifiers
FT   CDS             join(974216..974266,974409..974627,974691..974759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977836"
FT                   /orf_name="Pc16g04290"
FT                   /product="Putative uncharacterized protein Pc16g04290 "
FT                   /protein_id="CAP93099.1"
FT                   /db_xref="UniParc:UPI00018315E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L4"
FT                   /transl_table=1
FT                   /translation="MAPANAAQLLANTCKQFEISIHPKHKILNYASLTVGAISTSVAPS
FT                   SKQYHTITNSIKQTRGSLRVPGAEPLNYSVDRAAPLARNYLTKDEIVSSSSRLPFQDYI
FT                   SRITIRFV"
     MAPANAAQLL ANTCKQFEIS IHPKHKILNY ASLTVGAIST SVAPSSKQYH TITNSIKQTR        60
     GSLRVPGAEP LNYSVDRAAP LARNYLTKDE IVSSSSRLPF QDYISRITIR FV               112
//

If you have problems or comments...

PBIL Back to PBIL home page