(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE43

PENCW_13.PE43        Location/Qualifiers
FT   CDS             join(95191..95608,95822..96138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945520"
FT                   /orf_name="Pc16g00430"
FT                   /product="Pc16g00430 protein"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="CAP92713.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI0001831E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V4"
FT                   /transl_table=1
FT                   /translation="MASQSKLPQLTSSNLFVTEGGIETTLIYRNNLDLPSFSTLPLLNT
FT                   EDGRQTISSIYQEYVNIALAHSTGVVLETRTWRGSPLWSPEIGLSIPQILDLNRTAVKI
FT                   LHDIRNKTPSTSVVISGALGPLQDAYQDSTGTVSFVDRLTENYTTYFGVNCAHPRYIIK
FT                   AVRGMHTDVRSRIGSIRGNSSLKSHDELDNSLVLDRGDISVWVREFNELLNMLPGLKVV
FT                   GGCCGTDEEHIDAIASRINSVG"
     MASQSKLPQL TSSNLFVTEG GIETTLIYRN NLDLPSFSTL PLLNTEDGRQ TISSIYQEYV        60
     NIALAHSTGV VLETRTWRGS PLWSPEIGLS IPQILDLNRT AVKILHDIRN KTPSTSVVIS       120
     GALGPLQDAY QDSTGTVSFV DRLTENYTTY FGVNCAHPRY IIKAVRGMHT DVRSRIGSIR       180
     GNSSLKSHDE LDNSLVLDRG DISVWVREFN ELLNMLPGLK VVGGCCGTDE EHIDAIASRI       240
     NSVG                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page