(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE430

PENCW_13.PE430       Location/Qualifiers
FT   CDS             join(complement(975088..975612),complement(974876..975004))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948767"
FT                   /orf_name="Pc16g04300"
FT                   /product="Putative uncharacterized protein Pc16g04300 "
FT                   /protein_id="CAP93100.1"
FT                   /db_xref="UniParc:UPI00018315E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L5"
FT                   /transl_table=1
FT                   /translation="MAVARLRNLHVRPQFSPSHSLPLSLSLCLCLCLCLCLCLSVIQNL
FT                   RGTFTSDISNSSYTWDEMSQATPVRIVLPYREQPFQKPTAIINAFFTWRGIQPLREDYY
FT                   THICSDPRSSRLYLVLDLHCKTHPNVDLSNLDLEVFKVSGIDPLCVILFYNLTKLTVFS
FT                   TFQDLGEVARKQGGQYPAISMSCTSRSNGRSLRNPEGGMHGSFTVLLAGVQKIM"
     MAVARLRNLH VRPQFSPSHS LPLSLSLCLC LCLCLCLCLS VIQNLRGTFT SDISNSSYTW        60
     DEMSQATPVR IVLPYREQPF QKPTAIINAF FTWRGIQPLR EDYYTHICSD PRSSRLYLVL       120
     DLHCKTHPNV DLSNLDLEVF KVSGIDPLCV ILFYNLTKLT VFSTFQDLGE VARKQGGQYP       180
     AISMSCTSRS NGRSLRNPEG GMHGSFTVLL AGVQKIM                                217
//

If you have problems or comments...

PBIL Back to PBIL home page