(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE432

PENCW_13.PE432       Location/Qualifiers
FT   CDS             join(complement(980179..980301),complement(979691..980113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948768"
FT                   /orf_name="Pc16g04320"
FT                   /product="Pc16g04320 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP93102.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI00018315E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L6"
FT                   /transl_table=1
FT                   /translation="MAAAADKIKPYIPLAGCADDGWTKEDQATATCYCGGVQLAFPTQS
FT                   PGLVDTFICHCTDCRKITASMFATNFIIADTYLKHIRGEEILTAFKQSKTIASGKAMTN
FT                   CFCSTCGSLMYRISEAFPGHSILRTGTVDDFNLHETKLKPRTEMYAKDRVEWLCGASGV
FT                   KQVEGSMSTPKTTGPPRL"
     MAAAADKIKP YIPLAGCADD GWTKEDQATA TCYCGGVQLA FPTQSPGLVD TFICHCTDCR        60
     KITASMFATN FIIADTYLKH IRGEEILTAF KQSKTIASGK AMTNCFCSTC GSLMYRISEA       120
     FPGHSILRTG TVDDFNLHET KLKPRTEMYA KDRVEWLCGA SGVKQVEGSM STPKTTGPPR       180
     L                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page