(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE433

PENCW_13.PE433       Location/Qualifiers
FT   CDS             982455..983162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948769"
FT                   /orf_name="Pc16g04330"
FT                   /product="Pc16g04330 protein"
FT                   /protein_id="CAP93103.1"
FT                   /db_xref="UniParc:UPI00018315E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L7"
FT                   /transl_table=1
FT                   /translation="MSPATRLLDEYLKEGGYQKWGWVIYRSTYQNDEDWNCFKGVITEA
FT                   MRKSIEHHKTPDLDHSLNQSLSLTFLEDRPNFENASKDQLRAHFQEWAQRAYYAENPRP
FT                   FEEFNPDLATAPRYRYFIQIDEKSLQSLLHDTESGPRLRGLQSNGYVNFVDGWWKSLRE
FT                   QYATSQDPDLKEEIDEQLAHGYQSIEGCVEENTGWTMLHRLDMSVSFYHYTSGFVEDVW
FT                   PLYYQRPPGIALW"
     MSPATRLLDE YLKEGGYQKW GWVIYRSTYQ NDEDWNCFKG VITEAMRKSI EHHKTPDLDH        60
     SLNQSLSLTF LEDRPNFENA SKDQLRAHFQ EWAQRAYYAE NPRPFEEFNP DLATAPRYRY       120
     FIQIDEKSLQ SLLHDTESGP RLRGLQSNGY VNFVDGWWKS LREQYATSQD PDLKEEIDEQ       180
     LAHGYQSIEG CVEENTGWTM LHRLDMSVSF YHYTSGFVED VWPLYYQRPP GIALW            235
//

If you have problems or comments...

PBIL Back to PBIL home page