(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE434

PENCW_13.PE434       Location/Qualifiers
FT   CDS             985719..986294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948770"
FT                   /orf_name="Pc16g04340"
FT                   /product="Pc16g04340 protein"
FT                   /protein_id="CAP93104.1"
FT                   /db_xref="UniParc:UPI00018315EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L8"
FT                   /transl_table=1
FT                   /translation="MNTGTTQRAPKTPKPTASVPIVQNKRWPPMANRNALPYKLTHLSK
FT                   EKLAREATAPDPDLRRCVAHFRLHCGSVSWTENDMKSRISSFDFEDTDEEDDVDEINTE
FT                   LPVLKNRAPTNETPVEVTQQLSQKSEPVAVAATPTPPAPPASPESTSSTSSENSSEHGF
FT                   LEKGRNCLEATSKHLWTGGSCIVSPIAG"
     MNTGTTQRAP KTPKPTASVP IVQNKRWPPM ANRNALPYKL THLSKEKLAR EATAPDPDLR        60
     RCVAHFRLHC GSVSWTENDM KSRISSFDFE DTDEEDDVDE INTELPVLKN RAPTNETPVE       120
     VTQQLSQKSE PVAVAATPTP PAPPASPEST SSTSSENSSE HGFLEKGRNC LEATSKHLWT       180
     GGSCIVSPIA G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page