(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE435

PENCW_13.PE435       Location/Qualifiers
FT   CDS             join(complement(989283..991210),complement(989108..989221),
FT                   complement(988395..989037))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948771"
FT                   /orf_name="Pc16g04350"
FT                   /product="Pc16g04350 protein"
FT                   /protein_id="CAP93105.1"
FT                   /db_xref="UniParc:UPI00018315EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L9"
FT                   /transl_table=1
FT                   /translation="MKLDSRFFFFSLALAVQAYDDALGLSNGYTSLSTANFDIKLVKDS
FT                   QVLASLKPAGEAFDFLPFDDITYRAANGQYHNGDIAYRYRLSGSTEWTAGDSSKTRKSL
FT                   KSAESDALAAAEMTRTLPTSPIHILREWIDVDGDLGLTFTLTNKGKQTLEIGSLGFPTE
FT                   FNSIFSNRTAEDMVAKCSLTDPYIGMDAGYLQVNPTSGTGASLIVTPLFNTSTPLEAWR
FT                   NLGEPSTEPLLYGSQTFEGFYEWQTHTKAYAENEWSGVTPWNEPSSRLVSPGESVTYGL
FT                   RFTVVKDGVRGIHDAVKATNTPATPGIPRYVVPVDLTARLYVFHSRISEVVSEDNSFKI
FT                   TQGANGILSLTPTGSVWGRTRVTITYEDGKVQTVHYFIMDSVPATIGKLGEFSTTSMWF
FT                   NDTEDPFHRAPSVITWDHSTQAQVLQDPRVWISGLSDEGGVSYLASAMKQSGLADATEV
FT                   SKLEQFASDVLSKTIQNPDFTVRKSIFFYETAQLPEYTYDRSIDWGNWWSWNKDASYAT
FT                   DRAYNYIHVIGAYWALYRAGRDNGSLLKTHTWQWYLSQAYNTTVTCFATDSAGNGLVGY
FT                   SRLGLMGETVVGELLSDLRREEWTAEADAVEAAMKLRAEAWDTEDVPFGSEMAWDSTGQ
FT                   EGIYYWSNYFKLTNTATKTINSILGYMPTVPHWGWNGNARRYWDFIYGGKLQRIERMIH
FT                   HYGSSLNALPLLSHFRQNPTDTYLLRVGYGGIIGPLSNIRQDGSMYNAFHSFPDTLQGD
FT                   DYSGDYGPNFLGMMLGSAVYVVDDPDVGLVAYGGNIDTNGDTVTVQPRDAVRRRVYVAQ
FT                   MGVYVTISAGLIEEVSFDISRPTSLQLRIVPGSSDVSSVVAWVETPGTEDEYAVAGDQL
FT                   ERVRGGWNVKFASEEANVVVSKL"
     MKLDSRFFFF SLALAVQAYD DALGLSNGYT SLSTANFDIK LVKDSQVLAS LKPAGEAFDF        60
     LPFDDITYRA ANGQYHNGDI AYRYRLSGST EWTAGDSSKT RKSLKSAESD ALAAAEMTRT       120
     LPTSPIHILR EWIDVDGDLG LTFTLTNKGK QTLEIGSLGF PTEFNSIFSN RTAEDMVAKC       180
     SLTDPYIGMD AGYLQVNPTS GTGASLIVTP LFNTSTPLEA WRNLGEPSTE PLLYGSQTFE       240
     GFYEWQTHTK AYAENEWSGV TPWNEPSSRL VSPGESVTYG LRFTVVKDGV RGIHDAVKAT       300
     NTPATPGIPR YVVPVDLTAR LYVFHSRISE VVSEDNSFKI TQGANGILSL TPTGSVWGRT       360
     RVTITYEDGK VQTVHYFIMD SVPATIGKLG EFSTTSMWFN DTEDPFHRAP SVITWDHSTQ       420
     AQVLQDPRVW ISGLSDEGGV SYLASAMKQS GLADATEVSK LEQFASDVLS KTIQNPDFTV       480
     RKSIFFYETA QLPEYTYDRS IDWGNWWSWN KDASYATDRA YNYIHVIGAY WALYRAGRDN       540
     GSLLKTHTWQ WYLSQAYNTT VTCFATDSAG NGLVGYSRLG LMGETVVGEL LSDLRREEWT       600
     AEADAVEAAM KLRAEAWDTE DVPFGSEMAW DSTGQEGIYY WSNYFKLTNT ATKTINSILG       660
     YMPTVPHWGW NGNARRYWDF IYGGKLQRIE RMIHHYGSSL NALPLLSHFR QNPTDTYLLR       720
     VGYGGIIGPL SNIRQDGSMY NAFHSFPDTL QGDDYSGDYG PNFLGMMLGS AVYVVDDPDV       780
     GLVAYGGNID TNGDTVTVQP RDAVRRRVYV AQMGVYVTIS AGLIEEVSFD ISRPTSLQLR       840
     IVPGSSDVSS VVAWVETPGT EDEYAVAGDQ LERVRGGWNV KFASEEANVV VSKL             894
//

If you have problems or comments...

PBIL Back to PBIL home page