(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE436

PENCW_13.PE436       Location/Qualifiers
FT   CDS             join(complement(993381..993511),complement(992887..993319),
FT                   complement(992636..992833),complement(992308..992583))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824609"
FT                   /orf_name="Pc16g04360"
FT                   /product="Pc16g04360 protein"
FT                   /protein_id="CAP93106.1"
FT                   /db_xref="UniParc:UPI00018315EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q5"
FT                   /transl_table=1
FT                   /translation="MNEHEHNKAPNHSRPLLYVPNTLWTRLFAATVVIETVLTVAIESW
FT                   ILMSLWDDLDSDSESNGTMRLQSFLGLYIFALLYELALSYDALRRKNTIQLVGLCICNQ
FT                   GLFTYGLLQMNEIKDTISSSTNKDFGDRLKDVYHIEIIIVPVILGVGTVCMSFFTWKLR
FT                   AEFSWSIYKNVSADLQMKRRYFTYQVYIALLKFDFFFVFGTQLQILLVIFQAPEDMDFV
FT                   VNASVIPITIATLVLSAQFCKREKRKSLMFMMFLMLLIVGFLVLILLRMYSPGDHTDFS
FT                   SFRTSLTLFAGVSLLLMVLTIINSVMCILNFNKGLKNHVHPPKKGKTVSLELESQETPT
FT                   RFLLN"
     MNEHEHNKAP NHSRPLLYVP NTLWTRLFAA TVVIETVLTV AIESWILMSL WDDLDSDSES        60
     NGTMRLQSFL GLYIFALLYE LALSYDALRR KNTIQLVGLC ICNQGLFTYG LLQMNEIKDT       120
     ISSSTNKDFG DRLKDVYHIE IIIVPVILGV GTVCMSFFTW KLRAEFSWSI YKNVSADLQM       180
     KRRYFTYQVY IALLKFDFFF VFGTQLQILL VIFQAPEDMD FVVNASVIPI TIATLVLSAQ       240
     FCKREKRKSL MFMMFLMLLI VGFLVLILLR MYSPGDHTDF SSFRTSLTLF AGVSLLLMVL       300
     TIINSVMCIL NFNKGLKNHV HPPKKGKTVS LELESQETPT RFLLN                       345
//

If you have problems or comments...

PBIL Back to PBIL home page