(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE437

PENCW_13.PE437       Location/Qualifiers
FT   CDS             join(complement(997463..997627),complement(996642..997385),
FT                   complement(994573..996591))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671905"
FT                   /orf_name="Pc16g04370"
FT                   /product="Pc16g04370 protein"
FT                   /protein_id="CAP93107.1"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniParc:UPI00018315ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q6"
FT                   /transl_table=1
FT                   /translation="MASRIVPNILDPLSSSALNKLHEPAPPPIKKRKRGEQEELNDTAG
FT                   QLATSSIVIRAHSASLSDEPLILEPITALPRTRLPLSWLDDTPASRSDEQAGGLFTADI
FT                   PTLEIDLRAKTEPTVLAVRLVPNGGLYIIERVKMGLYSLSKLARWIHEGNLVVAAKGWQ
FT                   GIDAAVDGEAVDETGGIPDGFDWWQVAQIDEPLSDVEMGEKSAGLDIAVVFGSSESDVG
FT                   NIETSFVGVVEHRGQSLAPSRSFDAAEGGAFLLPESQGLGDDAAAMEVDGVDSNVVDVQ
FT                   QSPEELLDGMRDNYLQALYVSKTSVAYFAKGPLTRCRTAFQARDSEQPHGSIELIESYR
FT                   EAILATKKMDLKYRETLPSAIRDAVLALSDDGAKSKKRKSKKKKMGKNGLYPEEEAFIH
FT                   RWWKDRILNESSAQETSREAESKKQISDLRLRETQLQILLILEVMVLEMTIASAEKNNT
FT                   SKEKDVNGEQGTSKKTKPKRSTDLNVLLELHLDRMCIWHAVTMEETSAADTAKASSFSG
FT                   SHLSGKKVESDAVRDFCTEVIIPFYAARLPDKCKLITRKFGVSGGISPAAKKTQSSSKS
FT                   HRVEPGAEVKRQQPAPKPRRTLQRVLTDDKAAASQARHPGLTRSNTAPSQHNAKRDTEP
FT                   LLPTVLSGSVRGGIQKAKRTENREVDLNAVARQHEAKLRKVQMLANQKKELDAAIDALR
FT                   KPNRELVSKDLADDASKRAMSGGGSSRKSRNPVRNPFGEGVQVMATPRGNRRKDAAPRS
FT                   LAPSRSFAGVENSPFGESPIMIPSSSRRAISFSGADSDPFNSHDNPPGGRSPRSSQPDG
FT                   AIQETPTRPSSKIFQSDTIAARRPSSSTGKGLFRVPNLPAPRSSTQPMVPGSPVHSRPK
FT                   NISAFTENLSTSSRQFSQSLNHARASAIMETPPRRQAPQSISTPTAVPFSLSLDAMVTD
FT                   NPRAHSPPAVMGTPVKGAAAVPVTPDKSQSKSIYEQLGWDDEMEF"
     MASRIVPNIL DPLSSSALNK LHEPAPPPIK KRKRGEQEEL NDTAGQLATS SIVIRAHSAS        60
     LSDEPLILEP ITALPRTRLP LSWLDDTPAS RSDEQAGGLF TADIPTLEID LRAKTEPTVL       120
     AVRLVPNGGL YIIERVKMGL YSLSKLARWI HEGNLVVAAK GWQGIDAAVD GEAVDETGGI       180
     PDGFDWWQVA QIDEPLSDVE MGEKSAGLDI AVVFGSSESD VGNIETSFVG VVEHRGQSLA       240
     PSRSFDAAEG GAFLLPESQG LGDDAAAMEV DGVDSNVVDV QQSPEELLDG MRDNYLQALY       300
     VSKTSVAYFA KGPLTRCRTA FQARDSEQPH GSIELIESYR EAILATKKMD LKYRETLPSA       360
     IRDAVLALSD DGAKSKKRKS KKKKMGKNGL YPEEEAFIHR WWKDRILNES SAQETSREAE       420
     SKKQISDLRL RETQLQILLI LEVMVLEMTI ASAEKNNTSK EKDVNGEQGT SKKTKPKRST       480
     DLNVLLELHL DRMCIWHAVT MEETSAADTA KASSFSGSHL SGKKVESDAV RDFCTEVIIP       540
     FYAARLPDKC KLITRKFGVS GGISPAAKKT QSSSKSHRVE PGAEVKRQQP APKPRRTLQR       600
     VLTDDKAAAS QARHPGLTRS NTAPSQHNAK RDTEPLLPTV LSGSVRGGIQ KAKRTENREV       660
     DLNAVARQHE AKLRKVQMLA NQKKELDAAI DALRKPNREL VSKDLADDAS KRAMSGGGSS       720
     RKSRNPVRNP FGEGVQVMAT PRGNRRKDAA PRSLAPSRSF AGVENSPFGE SPIMIPSSSR       780
     RAISFSGADS DPFNSHDNPP GGRSPRSSQP DGAIQETPTR PSSKIFQSDT IAARRPSSST       840
     GKGLFRVPNL PAPRSSTQPM VPGSPVHSRP KNISAFTENL STSSRQFSQS LNHARASAIM       900
     ETPPRRQAPQ SISTPTAVPF SLSLDAMVTD NPRAHSPPAV MGTPVKGAAA VPVTPDKSQS       960
     KSIYEQLGWD DEMEF                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page