(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE44

PENCW_13.PE44        Location/Qualifiers
FT   CDS             complement(97348..98151)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945521"
FT                   /orf_name="Pc16g00440"
FT                   /product="Pc16g00440 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92714.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V5"
FT                   /transl_table=1
FT                   /translation="MGAEYCPVDDDGNYIQVDTIVASGDAALVVHREDMAIKMAIVYRH
FT                   YTLEQAEENRGIIRREQEVWRRIQPDFNTPVQGIIQCLGLRGDTIEMRYMPGGTLLKWL
FT                   QHRARPSIQLQKRWFRQLAIGLHNLHQHRVIHGDILSRNILMDGSLNVAICDLGASSLM
FT                   PMDTVMADAVDAYNCSIWTDLCQLGLVFYDIATGRTTGISLYDNGGSDNSVASFPSRDM
FT                   LPALSKRLWARDIIETCWREGGYGAAGAAGILAKLDKVKAPRRRR"
     MGAEYCPVDD DGNYIQVDTI VASGDAALVV HREDMAIKMA IVYRHYTLEQ AEENRGIIRR        60
     EQEVWRRIQP DFNTPVQGII QCLGLRGDTI EMRYMPGGTL LKWLQHRARP SIQLQKRWFR       120
     QLAIGLHNLH QHRVIHGDIL SRNILMDGSL NVAICDLGAS SLMPMDTVMA DAVDAYNCSI       180
     WTDLCQLGLV FYDIATGRTT GISLYDNGGS DNSVASFPSR DMLPALSKRL WARDIIETCW       240
     REGGYGAAGA AGILAKLDKV KAPRRRR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page