(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE443

PENCW_13.PE443       Location/Qualifiers
FT   CDS             join(complement(1010557..1010593),
FT                   complement(1010162..1010449),complement(1009988..1010062),
FT                   complement(1009749..1009930))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977837"
FT                   /orf_name="Pc16g04430"
FT                   /product="Pc16g04430 protein"
FT                   /protein_id="CAP93113.1"
FT                   /db_xref="UniParc:UPI00018316E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R1"
FT                   /transl_table=1
FT                   /translation="MDMDNTSRPAINIWTFFALAALDLAANAAAGPAAVATAAHVNGSP
FT                   LTARAMQIGALAGVTKSGVLAFVEFAAYAGLPTAAWILLALVASSFGICVLVTAEVSNL
FT                   VLGETPSALLVAAVVAAIPLSGECMGIYQSAGGLYGGQAQSQLFVLGLDALGGYVFARM
FT                   AHNGGQSLSLLYHESFGSTLFAAPVAPLDD"
     MDMDNTSRPA INIWTFFALA ALDLAANAAA GPAAVATAAH VNGSPLTARA MQIGALAGVT        60
     KSGVLAFVEF AAYAGLPTAA WILLALVASS FGICVLVTAE VSNLVLGETP SALLVAAVVA       120
     AIPLSGECMG IYQSAGGLYG GQAQSQLFVL GLDALGGYVF ARMAHNGGQS LSLLYHESFG       180
     STLFAAPVAP LDD                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page