(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE444

PENCW_13.PE444       Location/Qualifiers
FT   CDS             join(1011311..1011364,1011460..1012401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948774"
FT                   /orf_name="Pc16g04440"
FT                   /product="Pc16g04440 protein"
FT                   /protein_id="CAP93114.1"
FT                   /db_xref="UniParc:UPI00018316E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R2"
FT                   /transl_table=1
FT                   /translation="MNSTACVIEANPDVSGVGIRISIYALCLGGSIVNYLLRVFAPGED
FT                   QEEFSRGVSSALGLQGLALLCTAIYQTVRGELTLFHAICVVHLLAILGMDMVSKGRYSG
FT                   LGPWRLYFFSAIQVLVLAAFLALNVYVWVTAPQFGSQPQCNKNTVYVVFGVSINATSPV
FT                   FRYIILGTLGAIVAGYVLTFTCMLPCWCGYVVYRRRHPDAGNRTEGQKRGWMNWFVQVN
FT                   HPVYQDRRGPPERLYGQALLNFTLNKVAYCSFCIYLIVSLEQTIHRNNLDPEEEGWTFG
FT                   QVIAIFLLLGVANELLNVLLASWDRRQAESSQQLVQFRPGTGNTVHSLSS"
     MNSTACVIEA NPDVSGVGIR ISIYALCLGG SIVNYLLRVF APGEDQEEFS RGVSSALGLQ        60
     GLALLCTAIY QTVRGELTLF HAICVVHLLA ILGMDMVSKG RYSGLGPWRL YFFSAIQVLV       120
     LAAFLALNVY VWVTAPQFGS QPQCNKNTVY VVFGVSINAT SPVFRYIILG TLGAIVAGYV       180
     LTFTCMLPCW CGYVVYRRRH PDAGNRTEGQ KRGWMNWFVQ VNHPVYQDRR GPPERLYGQA       240
     LLNFTLNKVA YCSFCIYLIV SLEQTIHRNN LDPEEEGWTF GQVIAIFLLL GVANELLNVL       300
     LASWDRRQAE SSQQLVQFRP GTGNTVHSLS S                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page